KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR2596Help
Entry
SAR2596           CDS       T00182                                 

Definition
hypothetical protein
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SAR2596
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR2596
   00030 Pentose phosphate pathway
    SAR2596
   00051 Fructose and mannose metabolism
    SAR2596
  Energy metabolism
   00680 Methane metabolism
    SAR2596
Enzymes [BR:sar01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SAR2596
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
2681229..2683193
Genome map
AA seq 654 aa AA seqDB search
MTQITERELKKKYLDLLSQHFDTPEKLATEIINLESILELPKGTEHFVSDLHGEYEAFQH
VLRNGSGNVRAKINDIFKDKLSTKELNDLTALVYYPEDKLQLIKCDFQNYGQLNVWYITT
IEHLIQLIKYCSSKYTRSKLRRALPEQYVFIVEELLYKNNEFKNKKSYYETLVNQVIELK
QADDLIIGLAYSVQRLVVDHLHVVGDIYDRGPQPDKIMDTLINYHSLDIQWGNHDVLWVG
AYAGSKVCLANLLRICARYDNLDIVEDAYGINLRPLLTLAEKYYDADNPAFKPKKRPDKH
ERLTQREESQITKIHQAIAMIQFKLEIPVIKRRPNFEMDERLVLEKVNYDTNEITVYGKT
YPLKDTCFQTVNRDNPAKLLPEEEEVMNKLLLSFQQSEKLRRHMSFLMRKGSLYLPCNGN
LLIHGCIPVDENGEMESFEIDGQTYSGQELLDVFEYHVRKSFDEKENTDDLSTDLVWYLW
TGKYSSLFGKRAMTTFERYFIADKASHKEEKNPYYHLREDVNMVRKMLSDFGLNPDEGRI
INGHTPVKEINGEDPIKADGKMLVIDGGFSKAYQSTTGIAGYTLLYNSFGMQLVAHQQFN
AKEKILSEGIDELSIKRIVDKELQRKKIRNTNKGKELQAQIDILKMLMHDRYLD
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaattactgaaagagaattaaaaaagaaatatttggatttattatctcaacat
ttcgatactccagaaaagcttgcgactgaaattattaatttagaatctattttagaattg
cctaaaggtacggagcatttcgtcagcgatttacatggtgaatatgaagctttccaacac
gtattacgcaacggttctgggaacgtgcgagcgaaaattaatgatattttcaaagacaag
ttatcaacgaaagaacttaacgatttgactgcccttgtttactatccagaagacaaattg
caacttattaaatgtgattttcaaaattatggacaattaaatgtttggtatattacgacg
attgaacacctcattcagctaattaaatattgttcttcaaaatatacgcgttcaaaactt
cgacgtgccttgccggagcaatacgttttcatcgtagaagagttattatataagaacaac
gaatttaaaaataaaaaatcttactacgaaacacttgtaaaccaagtgattgagcttaag
caagcggatgatttaattatagggcttgcgtattctgtacaacgcttagtcgtcgatcat
ttacacgttgtcggcgatatttatgatcgtggcccgcaaccagataaaatcatggacacg
ctgattaattatcattctctggatattcaatggggtaatcatgatgtgctgtgggttggt
gcgtatgcagggtctaaagtatgtttagctaatttactacgtatttgtgcacgttatgac
aatctagatatcgttgaagatgcatacggtattaatttaagacctttgctaacattagcc
gaaaaatactatgatgcagataatcctgcttttaaacctaaaaaaaggcctgacaaacat
gaacgtttaactcaacgcgaagaaagtcagattactaaaattcatcaagcaattgcgatg
attcaattcaaactggaaataccggttattaagcgacgtccaaactttgaaatggacgaa
cgacttgtacttgaaaaagttaattatgatactaatgaaataacagtatacggaaaaaca
tatccattaaaagatacatgcttccaaactgttaaccgtgataacccagcaaagttacta
cctgaagaagaagaagtcatgaacaaactattattgtcattccagcaatctgaaaaatta
cgtcgtcatatgtctttcttgatgcgtaaaggctcactttacttaccttgtaatggcaat
ttactcattcatggttgtattccagttgatgaaaatggtgagatggaatcattcgaaatt
gatggtcagacatacagtggccaagagttattagatgtgtttgaatatcatgtccgtaaa
tcatttgatgaaaaagaaaatactgatgacttatccactgatttagtttggtatttatgg
actgggaaatactcttcactatttggtaaacgtgcgatgactacgtttgaacgatacttt
attgcagataaagcttctcataaagaagaaaagaatccgtactatcatcttcgtgaagat
gtgaatatggttcgtaaaatgctcagtgatttcggattaaatccagatgaaggacgcatt
attaatggtcacacaccagtgaaagaaattaatggcgaagatcctatcaaagctgatgga
aagatgcttgtcattgatggcggcttttcaaaagcttatcagtcaacaactggcattgca
ggctatacattgttgtataattcattcggaatgcaactcgttgcacatcaacaatttaac
gcaaaagaaaaaattctttccgaaggtatcgacgaactgtcaattaaacggattgttgat
aaagaattacaacgtaaaaaaatccgcaatacaaataaaggtaaagagcttcaggctcaa
atagatattttgaaaatgttaatgcatgatcgttacttagactaa

DBGET integrated database retrieval system