KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR2687Help
Entry
SAR2687           CDS       T00182                                 

Definition
(GenBank) putative AMP-binding enzyme
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
sar00010  Glycolysis / Gluconeogenesis
sar00620  Pyruvate metabolism
sar00640  Propanoate metabolism
sar00680  Methane metabolism
sar01100  Metabolic pathways
sar01110  Biosynthesis of secondary metabolites
sar01120  Microbial metabolism in diverse environments
sar01130  Biosynthesis of antibiotics
sar01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAR2687
   00620 Pyruvate metabolism
    SAR2687
   00640 Propanoate metabolism
    SAR2687
  Energy metabolism
   00680 Methane metabolism
    SAR2687
Enzymes [BR:sar01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SAR2687
Lipid biosynthesis proteins [BR:sar01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SAR2687
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C Atu4866
Motif
Other DBs
NCBI-ProteinID: CAG41664
GeneDB: SAR2687
Position
complement(2773938..2775557)
Genome map
AA seq 539 aa AA seqDB search
MYERKLVMQKSALFAPEKYNIISEIEKYSHIPDKKAILYHNTEGEDISVTYQQLIEQSNK
VGNVLASHGLSKGDKVLIMMPRSIATYELYIAALKLGVAIIPCSEMLRTKDLQYRITHGE
INAVIALEPFTVEFEKIKEYDALTKFVIAGQKDGWISLEAEKENASNKLEMADTTRDDMA
ILSYTSGTTGNPKAVTHCHGWGFAHLQMAPKHWLCINEDDLVWATAAPGWQKWVWSPFLS
VLGSGATAFVFNGRFSPETYLELLQKYQINVLCCTPTEYRMMAKLQNLNDYDLTHLHSAV
SAGEPLNREVVEQFKKYFNLTVRDGYGQTESTLLIGFLKDTPQRIGSMGKGIPDSSVTVV
DDEGNSVPANTKGNIAVPLDLPALFKGYYKEPERTAKAQTGKYYITGDLAHVDDDGYFWF
EGRRDDIIISSGYTIGPFEVEDALTNHPAVKECAVVAKPHDIRGNIVKAFVILQDHTAGD
DTLVKELQQFVKNEVAPYKYPREIEFVDDLPKTNSGKIRRVELRDAEIEKWQQQKDSNQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaaaggaagttagttatgcaaaagtcagctctattcgcgcctgaaaaatataac
attatttcggaaatcgaaaaatatagccacataccagataaaaaggcaattttatatcat
aatactgaaggcgaagatatatcagtcacttaccaacagctcattgaacagtctaataaa
gtaggtaatgttttagcatcgcatggtttatctaaaggcgataaagtactcattatgatg
ccacgatctattgcgacatatgaattatatattgctgctttaaaattaggtgttgcaatc
attccatgttctgaaatgctaagaactaaagatttacaataccgtatcacacacggtgaa
ataaatgctgttattgcactagagccattcacagttgaatttgaaaaaattaaagaatat
gatgcgttaactaaatttgttattgccggtcaaaaagatggatggatttcacttgaagct
gaaaaagaaaacgcaagtaacaaactagaaatggcagatacgacgcgtgatgatatggcg
attctgtcatatacatctggtacaactggcaatcctaaagccgttacacattgtcatgga
tggggatttgcacatttacaaatggcaccaaaacattggttatgtattaatgaagatgac
ttagtttgggcaacagcagcaccaggttggcaaaaatgggtatggagtcctttcttatct
gtattaggttcaggtgcaactgcttttgtatttaatggaagattcagccctgagacatac
ttagaattgcttcaaaaatatcaaattaatgttttatgttgtacaccgacagaatatcgt
atgatggctaaattacagaacttaaatgattatgacttaacgcatttacatagtgccgtt
tctgcaggtgagccactaaatcgagaagtagttgaacaattcaagaaatactttaattta
actgtaagagatggatatggccagactgaaagtaccttgcttataggctttttaaaagat
acaccacaaaggattggatcaatgggtaaaggcattccggatagttcggtcactgtagta
gatgatgaggggaatagcgtacctgctaatacgaaagggaatattgcagtaccacttgat
ttgccagcacttttcaaaggatattataaagagccagaacgtacggcgaaagcgcaaaca
ggtaaatactacatcactggtgacttagctcatgtagatgatgatggttatttctggttt
gaaggacgtcgagatgacattattattagttcaggctatacgattgggccttttgaagtt
gaagatgcgttaacgaatcatccagccgttaaagaatgtgctgtagtagcaaaacctcat
gatatacgaggaaatattgttaaagcattcgttattttacaggaccatactgcgggtgat
gatacgctagttaaagaactacaacaatttgttaaaaatgaagttgcaccatataaatat
ccaagagagattgaattcgttgacgacttaccaaaaacaaactcaggtaaaattcgtcgt
gttgaactacgagatgctgaaatagaaaaatggcaacaacaaaaagatagcaatcaataa

DBGET integrated database retrieval system