KEGG   Staphylococcus aureus subsp. aureus MRSA252 (MRSA): SAR2699Help
Entry
SAR2699           CDS       T00182                                 

Definition
glutathione peroxidase (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sar  Staphylococcus aureus subsp. aureus MRSA252 (MRSA)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:sar00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    SAR2699
  Metabolism of other amino acids
   00480 Glutathione metabolism
    SAR2699
Enzymes [BR:sar01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     SAR2699
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2790963..2791460)
Genome map
AA seq 165 aa AA seqDB search
MNNRNVYDIEVSDYKGLTYKLEAFRGKVILVVNTATECIYSEQLKKLETLFQKYKDRGFV
VLSFPNNNFDNRQPGSNEEILKISREKFGVTFPVLAKISVNGNDEHPLFTHLKNEQPGIF
GSPIKWNFTKFIIDRQGNVVNRFLPMEDPLDISANIEILLQESSS
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaataatagaaatgtgtatgatatcgaagtaagtgattataaaggcttaacttataaa
ttagaagcatttagaggtaaagtgattttagttgttaatactgcaacagaatgtatatat
agcgaacaattgaaaaaactagagactttgtttcaaaaatataaggatcgtgggtttgta
gtgttgagttttccgaataataattttgacaatcgacaaccaggttctaatgaagaaatc
ttgaaaattagtcgtgagaaatttggtgttacatttccagtgctagctaaaatatctgtg
aacgggaacgatgaacatccgttatttacgcatttaaagaatgaacaaccaggaatcttt
gggtccccaataaaatggaatttcacaaaatttataatcgatcgacaaggcaatgttgta
aatcgattcttgccaatggaagatccattggatatatcggcaaatatagaaatattattg
caagaatcttcatcttaa

DBGET integrated database retrieval system