KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS0126Help
Entry
SAS0126           CDS       T00183                                 

Definition
capsular polysaccharide synthesis enzyme
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
145691..146455
Genome map
AA seq 254 aa AA seqDB search
MIDIHNHILPNIDDGPTNETEMLDLLKQATTQGVTEIIVTSHHLHPRYTTPIEKVKSCLN
HIESLEEVQALNLKFYYGQEIRITDQILNDIDRKVITGINDSRYLLIEFPSNEVPHYTDQ
LFFELQSKGFVPIIAHPERNKAISQNLDILYDLINKGALSQVTTASLAGISGRKIRKLAI
QMIENNLTHFIGSDAHNTEIRPFLMKDLFNDKKLRDYYEDMNGFISNAKLVVDDKKIPKR
MPQQDYKQKRWFGL
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgattgatattcataaccatatattgcctaatatcgatgacggtccgacaaatgaaaca
gagatgctggatcttttaaaacaagcgacaacacaaggtgttacagaaatcattgtaaca
tcacatcacttacatcctcgatataccacacctatagaaaaagtgaaatcatgtttaaac
catattgaaagcttagaggaagtacaagcactaaatctaaagttttattatggtcaggaa
ataagaattaccgatcaaatccttaatgatattgatcgaaaagttattaccggtattaat
gattcacgctatttactaatagaatttccatcaaatgaagttccacactatactgatcaa
ttatttttcgaattacagagtaaaggctttgtaccgattattgcacatccagagcggaat
aaagcaataagtcaaaaccttgacatactatacgatttaattaacaaaggtgctttaagt
caagtgacaacggcgtcattagcgggtatttccggtagaaaaattagaaaattagcaatt
caaatgattgaaaacaatctgacacatttcatcggttcagatgcgcataacacagaaatc
agaccgttcttaatgaaagacttatttaatgataagaaattacgtgattattatgaagat
atgaacggatttattagtaatgcgaagttagttgttgatgataaaaaaattcctaaacga
atgccacaacaagattataaacagaaaagatggtttgggttataa

DBGET integrated database retrieval system