KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS0243Help
Entry
SAS0243           CDS       T00183                                 

Definition
6-phospho-beta-glucosidase (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:sas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAS0243
Enzymes [BR:sas01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     SAS0243
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
287301..288737
Genome map
AA seq 478 aa AA seqDB search
MTKLPRNFMWGGALAANQFEGGYDKGGKGLSVIDVMTSGAHGKARQITKSIDQNHYYPNH
EGIDFYHRYKEDIALFNEMGLKCLRTSIAWTRIFPNGDEDVPNEEGLAFYDRIFDELIAQ
DIEPVVTLSHFEMPLHLAKHYGGFRNREVVDYFVHFARVVFERYKDKVTYWMTFNEINNQ
MDTSNPIFLWTNSGVALTENDNPEEVLYQVAHHELLASALAVRLGKEINPKFKIGTMISH
VPIYPYSCHPKDMMEAQIANRLRFFFPDVQVRGYYPSYAKKMLARKGYDVGWQEGDDSIL
QQGTVDYIGFSYYMSTAVKHDVDTTVENNIVNGGLNHSVENPHIATSDWGWAIDPDGLRY
TLNVLYDRYQLPLFIVENGFGAVDEVVDGHIHDDYRIEYLKAHITAAIEAVDQDGVDLIG
YTPWGIIDIVSFTTGEMKKRYGLIYVDRDNDGHGTMERLKKDSFYWYQQVIASNGDKL
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattaccgcgaaattttatgtggggtggcgctcttgccgcaaatcaatttgaa
ggtggatatgataaagggggtaaagggttaagtgtaattgatgttatgacgagtggtgca
catggcaaagcacgtcagattacaaagtctatagatcaaaatcactattatccaaatcat
gaaggtattgatttttatcatcgttataaggaagatattgccttgtttaatgaaatggga
ttgaaatgtttacgtacgtcgattgcgtggacacgtatctttccgaatggggatgaagat
gtgccaaacgaagaaggactcgccttttatgatcgtatctttgatgaattaattgcacaa
gatattgaacctgttgtgacgttatcacattttgagatgccacttcatttagcgaaacat
tatggtggatttagaaatagagaagttgtcgattattttgtgcattttgcgcgtgttgta
tttgaaagatataaagataaagtgacatattggatgacgtttaatgaaattaataatcag
atggacacatcaaatcctatctttttatggacgaattctggggtagcattgacagaaaat
gataatcctgaagaagtcttgtatcaagtagcacatcatgaacttttagccagtgcttta
gcagttcgtcttggtaaagagattaatccgaagtttaagattggaacaatgatttcacat
gtacccatttatccatattcgtgtcatccgaaagatatgatggaagcacaaattgcgaat
cgcttacgtttctttttcccggatgtccaagtgagaggttattatccaagctatgctaaa
aaaatgttggcacgaaaaggatatgatgttggatggcaagaaggggacgacagtatttta
cagcagggcacggttgattatattggctttagttattacatgtctacggctgtaaaacat
gatgttgatactacagttgaaaacaacatcgtcaacggtggtttgaatcattctgtggag
aatccgcatatcgcaacgagtgattggggttgggcgattgatccagatggcttaagatat
acattgaatgtgttatatgatcgttatcagttaccactttttattgtggaaaatggtttt
ggtgcagttgatgaagtggtagatggacatattcatgatgattatcgcattgaatattta
aaagcacatattacagcagcgatagaagcagttgatcaagatggtgtagatttaatcggt
tatacaccgtggggaatcattgatattgtttcatttacaaccggtgaaatgaagaaacgc
tatggtttaatatatgttgatcgagataatgatggtcatggcacgatggaacgcttgaaa
aaagattcgttctattggtatcaacaagtgatagcatcaaatggagataaattataa

DBGET integrated database retrieval system