KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS0473Help
Entry
SAS0473           CDS       T00183                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sas00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SAS0473
Enzymes [BR:sas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     SAS0473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
530370..530846
Genome map
AA seq 158 aa AA seqDB search
MIQAYLGLGSNIGDRESQLNDAIKILNEYDGINVSNISPIYETAPVGYTEQPNFLNLCVE
IQTTLTVLQLLECCLKTEECLHRIRKERWGPRTLDVDILLYGEEMIDLPKLSVPHPRMNE
RAFVLIPLNDIAANVVEPRSKLKVKDLVFVDDSVKRYK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgattcaagcatacttaggattaggtagtaatattggtgatagagaaagccagttaaac
gatgctataaagattttgaatgaatatgatggtattaacgtatctaatatttctccgatt
tatgaaacagcaccagttgggtatactgagcaacctaactttttaaatttgtgtgttgaa
attcaaacaacactcacagtattacaactgttggaatgttgtttgaagacagaagaatgt
ttacaccgtattagaaaggaacgatggggtcctagaactttagatgtggatattttgttg
tatggagaagaaatgatagatttaccaaaactgtcggtgccacatccgagaatgaatgaa
cgtgcatttgttttaatcccattaaatgatatagcagcaaatgtcgtagaaccacgttcg
aaattgaaagtgaaagatttagtttttgtagatgacagtgtaaagagatataaataa

DBGET integrated database retrieval system