KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS0745Help
Entry
SAS0745           CDS       T00183                                 

Definition
(GenBank) putative carboxylesterase
  KO
K03928  carboxylesterase [EC:3.1.1.1]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Brite
Enzymes [BR:sas01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     SAS0745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_1 DLH Peptidase_S9 Abhydrolase_6 BAAT_C Abhydrolase_3 PhoPQ_related DUF2048 FSH1 Chlorophyllase2 DUF4611 Chlorophyllase
Motif
Other DBs
NCBI-ProteinID: CAG42520
GeneDB: SAS0745
Position
833773..834513
Genome map
AA seq 246 aa AA seqDB search
MQIKLPKPFFFEEGKRAVLLLHGFTGNSSDVRQLGRFLQKKGYTSYAPQYEGHAAPPEEI
LKSSPFVWFKDALDGYDYLVEQGYDEIVVAGLSLGGDFALKLSLNRDVKGIVTMCAPMGG
KTEGAIYEGFLEYARNFKKYEGKNQETIDNEMDHFKPTETLKELSEALDTIKDQVDEVFD
PILVIQAENDNMIDPQSANYIYDHVDSDDKDIKWYSQSGHVITIDKEKEQVFEDIYQFLE
SLDWSE
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgcagataaaattaccaaaacctttcttttttgaagaaggcaaacgtgccgtgttatta
ttacatggatttacaggcaattcgtctgatgtacgtcaattaggtcgatttttacaaaaa
aagggatatacttcgtatgcaccacaatatgaaggtcacgcggcaccaccagaggaaata
ctgaaatctagtcctttcgtttggtttaaagatgcgttagatggttatgattatcttgtt
gaacaaggttatgatgaaattgttgttgctggtctatcattaggtggggattttgcttta
aaattaagcttaaatagagatgtaaagggtattgtaacgatgtgtgcaccaatgggtggc
aaaactgaaggtgccatttatgaaggctttttagagtatgcacgtaattttaaaaagtat
gaaggtaaaaatcaagagactattgataatgaaatggatcattttaaaccaactgaaact
ttaaaagaactaagtgaagcattagatacgattaaagatcaagttgatgaggtatttgac
ccaattttagtgattcaagcagaaaacgacaatatgattgatccacaatccgcaaattat
atatatgaccatgtagattctgatgacaaagacatcaagtggtatagtcaatcaggacat
gttattacgattgataaagaaaaagaacaagtatttgaagatatttatcaatttttagag
tcattagactggtcagaataa

DBGET integrated database retrieval system