KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS1195Help
Entry
SAS1195           CDS       T00183                                 

Definition
phosphatidate cytidylyltransferase
Orthology
K00981  
phosphatidate cytidylyltransferase [EC:2.7.7.41]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sas00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SAS1195
Enzymes [BR:sas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.41  phosphatidate cytidylyltransferase
     SAS1195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1278237..1279019
Genome map
AA seq 260 aa AA seqDB search
MKVRTLTAIIALIVFLPILLKGGLVLMIFANILALIALKELLNMNMIKFVSVPGLISAVG
LIIIMLPQHAGPWVQVIQLKSLIAMSFIVLSYTVLSKNRFSFMDAAFCLMSVAYVGIGFM
FFYETRSEGLHYILYAFLIVWLTDTGAYLFGKMMGKHKLWPVISPNKTIEGFIGGLFCSL
IVPLAMLYFVDFNMNVWILLGVTLILSLFGQLGDLVESGFKRHFGVKDSGRILPGHGGIL
DRFDSFMFVLPLLNILLIQS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttagaacgctgacagctattattgccttaatcgtattcttgcctatcttgtta
aaaggcggccttgtgttaatgatatttgctaatatattagcattgattgcattaaaagaa
ttgttgaatatgaatatgattaaatttgtttcagttcctggtttaattagtgcagttggt
cttatcatcattatgttgccacaacatgcagggccatgggtacaagtaattcaattaaaa
agtttaattgcaatgagctttattgtattaagttatactgtcttatctaaaaacagattt
agttttatggatgctgcattttgcttaatgtctgtggcttatgtaggcattggttttatg
ttcttttatgaaacgagatcagaaggattacattacatattatatgcctttttaattgtt
tggcttacagatacaggggcttacttgtttggtaaaatgatgggtaaacataagctttgg
ccagtaataagtccgaataaaacaatcgaaggattcataggtggcttgttctgtagtttg
atagtaccacttgcaatgttatattttgtagatttcaatatgaatgtatggatattactt
ggagtgacattgattttaagtttatttggtcaattaggtgatttagtggaatcaggattt
aagcgtcatttcggcgttaaagactcaggtcgtatactacctggacacggtggtatttta
gaccgatttgacagctttatgtttgtgttaccattattaaatattttattaatacaatct
taa

DBGET integrated database retrieval system