KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS1233Help
Entry
SAS1233           CDS       T00183                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sas00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SAS1233 (glpK)
Enzymes [BR:sas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SAS1233 (glpK)
Exosome [BR:sas04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SAS1233 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
1326270..1327766
Genome map
AA seq 498 aa AA seqDB search
MEKYILSIDQGTTSSRAILFNQKGEIAGVAQREFKQYFPQSGWVEHDANEIWTSVLAVMT
EVINENDVRADQIAGIGITNQRETTVVWDKHTGRPIYHAIVWQSRQTQSICSELKQQGYE
QTFRDKTGLLLDPYFAGTKVKWILDNVEGAREKAENGDLLFGTIDTWLVWKLSGKAAHIT
DYSNASRTLMFNIHDLEWDDELLELLTVPKNMLPEVKPSSEVYGKTIDYHFYGQEVPIAG
VAGDQQAALFGQACFERGDVKNTYGTGGFMLMNTGDKAVKSESGLLTTIAYGIDGKVNYA
LEGSIFVSGSAIQWLRDGLRMINSAPQSESYATRVDSTEGVYVVPAFVGLGTPYWDSEAR
GAIFGLSRGTEKEHFIRATIESLCYQTRDVMEAMSKDSGIDVQSLRVDGGAVKNNFIMQF
QADIVNTSVERPEIQETTALGAAFLAGLAVGFWESKDDIAKNWKLEEKFDPKMDEGEREK
LYRGWKKAVEATQVFKTE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaatatattttatctatagaccaaggaacaacaagctcaagagcgattttattc
aatcaaaaaggggaaattgcaggggtagcacaacgtgagtttaagcaatattttccacaa
tcaggttgggttgaacatgatgcaaatgaaatttggacatctgtgttagctgtaatgacg
gaagtaattaatgaaaatgatgttagagctgatcaaattgcaggtatcggtattacaaac
caacgcgaaacaacggtggtttgggacaaacatactggccgcccaatttatcacgcaatt
gtttggcaatcacgtcaaacacaatcaatttgttcagaattaaaacaacaaggatatgaa
caaacatttagagataagacaggattacttttagatccgtattttgcaggtacaaaagtt
aaatggattctagacaatgttgaaggtgcacgagaaaaagcagaaaatggcgatctatta
tttggaacgattgatacttggttagtatggaaattatcaggaaaagctgcgcatattact
gattattcaaatgcgagtcgtacattaatgtttaatatccatgatttagaatgggacgat
gagttattagaactacttacagtacctaaaaatatgttgccagaagttaaaccttcaagt
gaagtatatggtaagacaattgattaccacttctatggtcaagaagtaccaatcgctggt
gtagctggtgatcaacaagcagcattatttggacaagcttgcttcgaacgtggtgacgtg
aaaaacacatatggaactggtggcttcatgttaatgaatacaggtgacaaagcggttaaa
tctgaaagtggtttattaacaacaattgcttatggtattgatggaaaagtaaattatgcg
cttgaaggttccatctttgtttcgggttcagcaatccaatggttacgtgatggattaaga
atgattaattcagcaccacaatcagaaagttatgcgacacgagttgactctactgagggt
gtttatgttgttccagcttttgtaggtttaggaacaccatattgggattctgaagcacgt
ggtgcgattttcggtttatcacgtggaactgaaaaagagcactttatccgtgcaactata
gaatcactatgttaccaaactcgtgacgttatggaagcaatgtcaaaagactctggcatt
gatgtccaaagtttacgtgtcgatggtggtgcagttaaaaacaactttattatgcagttc
caagcagacattgttaatacttctgttgaaagacctgaaattcaagaaactacagcttta
ggtgctgcatttttagcaggattagcagttggattctgggagagtaaagatgatatcgct
aaaaactggaaattagaagaaaaattcgatccgaaaatggatgaaggcgaaagagaaaaa
ttatatagaggttggaaaaaagctgttgaagcaacacaagtttttaaaacagaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system