KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS1313Help
Entry
SAS1313           CDS       T00183                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00260  Glycine, serine and threonine metabolism
sas00400  Phenylalanine, tyrosine and tryptophan biosynthesis
sas01100  Metabolic pathways
sas01110  Biosynthesis of secondary metabolites
sas01130  Biosynthesis of antibiotics
sas01230  Biosynthesis of amino acids
Module
sas_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sas00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAS1313
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SAS1313
Enzymes [BR:sas01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SAS1313
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA BtpA DUF561 His_biosynth IGPS
Motif
Other DBs
NCBI-ProteinID: CAG43090
GeneDB: SAS1313
UniProt: Q6G9I6
Position
1408697..1409425
Genome map
AA seq 242 aa AA seqDB search
MTKLFIPYIMGNKDLIENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DYIFNQLEKHGDQIKCNYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPYELSQRL
KQQFSHYGVKIISLVAMTTDDKRIKDIVSHAEGFIYTVTMNATTGQNGAFHPELKRKIES
IKAIANVPVVAGFGIRTPQHVADIKEVADGIVIGSEIVKRFKSNTREEIIKYLQSIQQTL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttataccttatattatgggcaataaagatttgattgaaaatgcaaca
ttgttgagtgaaaatggtgcagatataattgaaattggagtacctttctctgatccggtt
gctgatggtccagttatcatggaagcaggtcaacaagcgattaaacaaggcatcacgata
gattatattttcaatcaattagaaaaacatggtgatcaaattaagtgtaactatgtatta
atgacgtattataatattatttgtcattatggagaacaagcgttttttgaaaaatgtcga
gatactggtgtctacggcttaattattcctgatttaccatatgaattatcgcagcgttta
aaacaacaatttagtcactatggcgtcaaaatcatatcgttagttgcgatgactactgat
gacaaacgtataaaagatatcgtatcccatgcggaaggctttatttatactgtgacgatg
aatgcgacaacagggcaaaacggtgcgtttcatccagaattaaaacgaaaaattgagtca
attaaagcgatagccaatgtgccagttgtcgcaggatttggtataagaacaccacaacat
gttgcagatataaaagaggttgcagatggcattgtcattggtagcgaaatcgttaagcga
tttaaatctaacacgcgtgaggaaatcattaaatatttacaatctatccaacaaacattg
aataattaa

DBGET integrated database retrieval system