KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS2307Help
Entry
SAS2307           CDS       T00183                                 

Definition
(GenBank) putative phosphoglycerate mutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
sas00010  Glycolysis / Gluconeogenesis
sas00260  Glycine, serine and threonine metabolism
sas00680  Methane metabolism
sas01100  Metabolic pathways
sas01110  Biosynthesis of secondary metabolites
sas01120  Microbial metabolism in diverse environments
sas01130  Biosynthesis of antibiotics
sas01200  Carbon metabolism
sas01230  Biosynthesis of amino acids
Module
sas_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
sas_M00002  Glycolysis, core module involving three-carbon compounds
sas_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sas00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SAS2307
  Energy metabolism
   00680 Methane metabolism
    SAS2307
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SAS2307
Enzymes [BR:sas01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SAS2307
Membrane trafficking [BR:sas04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    SAS2307
Exosome [BR:sas04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SAS2307
  Exosomal proteins of melanoma cells
   SAS2307
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: CAG44120
GeneDB: SAS2307
UniProt: Q6G6Q5
Position
complement(2466147..2466833)
Genome map
AA seq 228 aa AA seqDB search
MPKLILCRHGQSEWNAKNLFTGWEDVNLSEQGINEATRAGEKVRENNIAIDVAFTSLLTR
ALDTTHYILTESKQQWIPVYKSWRLNERHYGGLQGLNKDDARKEFGEEQVHIWRRSYDVK
PPAETEEQREAYLADRRYNHLDKRMMPYSESLKDTLVRVIPFWTDHISQYLLDGQTVLVS
AHGNSIRALIKYLEDVSDEDIINYEIKTGAPLVYELTDDLEVIDKYYL
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaattaattttatgtcgtcatggacaaagcgagtggaatgctaaaaacttattt
actggatgggaagatgttaatttatctgaacaaggtattaatgaagcgactagagcaggt
gaaaaagtaagagaaaataacattgccatcgatgtagcttttacatcgttattaacacgt
gctttagatacaacgcattatattttaactgaatctaaacaacaatggattcctgtatat
aaaagctggcgtttaaatgaacgccactatggtggattgcaaggcttaaataaagatgat
gctagaaaagaatttggagaagaacaagtacatatttggcgtcgttcttatgatgtgaaa
ccacctgctgaaaccgaagaacaacgtgaagcttacttagctgatcgtcgatataatcat
ttagataaacgtatgatgccttattctgaaagtctgaaagatactttagttcgagtgata
ccattttggacagatcatatttcacaatatttgctagatggtcaaacggtattagtttct
gcacacggaaattcaattcgcgcattaattaaatatcttgaagatgtgtcagatgaagat
atcattaattatgaaattaaaacaggtgcaccgcttgtttatgaattaacggatgattta
gaagttatagataaatactacttataa

DBGET integrated database retrieval system