KEGG   Staphylococcus aureus subsp. aureus MSSA476 (MSSA): SAS2354Help
Entry
SAS2354           CDS       T00183                                 

Definition
oligopeptide transporter ATPase
Orthology
K10824  
nickel transport system ATP-binding protein [EC:3.6.3.24]
Organism
sas  Staphylococcus aureus subsp. aureus MSSA476 (MSSA)
Pathway
ABC transporters
Module
Nickel transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:sas02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
GeneDB: 
UniProt: 
Position
complement(2520718..2521467)
Genome map
AA seq 249 aa AA seqDB search
MIKIKDVEKSYQSAHVFKRRRTPIVKGVSFECPIGATIAIIGESGSGKSTLSRMILGIEK
PDKGCVTLNDQPMHKKKVRRHQIGAVFQDYTSSLHPFQTVREILFEVMCQCDGQPKDVME
VQAITLLEEVGLSKAYMDKYPNMLSGGEAQRVAIARAICINPKYILFDEAISSLDMSIQT
QILDLLIHLRETRQLSYIFITHDIQAATYLCDQLIIFKNGKIEEQIPTSALHKSDNAYTR
ELIEKQLSF
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgattaaaattaaagatgttgaaaagtcatatcaaagcgcacatgtttttaagcgtcgt
cgaacacctatcgtgaaaggtgtgtcatttgagtgtccaatcggtgcgacgattgcgatt
atcggagaaagtggtagcggtaaatcgacattgagtcgtatgatattaggtattgagaaa
ccggataaaggttgtgtaaccttaaatgatcaaccgatgcataagaagaaagtgagacgt
catcaaattggtgctgtatttcaagattatacgtcatcattacatccatttcagactgtt
agagaaatcttatttgaagtgatgtgtcaatgtgatggacaacctaaagatgttatggaa
gttcaagcaattacattgttggaagaagtcggtctatctaaggcatacatggataaatat
cctaatatgttatcaggtggagaggcgcaacgtgttgcgattgcgcgtgcaatatgtatt
aaccctaaatatattttgtttgatgaagccattagttcactcgacatgtcaattcaaaca
caaatattagatttattgattcatttacgtgaaacgcgtcagttgagttatatttttatc
acacatgatattcaagctgccacgtatttatgtgatcaattaattatttttaaaaacgga
aaaatagaagaacaaattccgacaagcgcattgcataaaagtgacaatgcttatacaaga
gaattaatagaaaaacaactatcattctaa

DBGET integrated database retrieval system