KEGG   Salmo salar (Atlantic salmon): 106576716Help
Entry
106576716         CDS       T04363                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD12-like
  KO
K13704  
abhydrolase domain-containing protein 12 [EC:3.1.1.23]
Organism
sasa  Salmo salar (Atlantic salmon)
Brite
Enzymes [BR:sasa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     106576716
Peptidases [BR:sasa01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   106576716
Exosome [BR:sasa04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   106576716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
ssa18
AA seq 406 aa AA seqDB search
MRKRNNSLTVDHDSSSTNTLLDSSPDLNYCHKRGEGVPEPCLPSSSESDKTMGRPFRRVC
CLGLVSVRDFTLHVGYGLMGRLKRILLWVLGVYITIPFIVKLCPSIQAKLVFLNFVRLPY
FIDLKRPQDHGLNHTFNFYLQPETGVNIGVWHTVPDQMWKEAQGKDREWYDSTFKSPYPV
MLYLHGNAGTRGGDHRVQLYKVLSLLGYHVVTFDYRGWGDSDGSPSERGMTSDALFLYQW
VKERVGSKPLNVWGHSLGTGVATNLVRHLCDRGTPPNSLVLESPFTNIREEAKSHPFSMV
YRYLPGFEWFFLDTISANDIRFASDENVDHISCPLLILHAEDDSVVPFNLGKKLYNIASQ
SKSLSGHKLQFIPFPVSLAYKHKFIYRSPELPHILSDFLGTTHPHA
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaagcgaaataactcgctcaccgtggaccatgacagctcttccaccaacacattg
ctggacagcagtccggatttaaactactgtcacaagagaggggaaggggttcctgagcct
tgtttaccatctagctcggaatcggacaaaacaatgggcagaccatttagaagggtgtgc
tgtttgggcctagtatctgtcagggacttcaccctccatgtgggatatggcctaatgggc
agattgaagaggatcctcctgtgggtgctgggagtctacataaccatccccttcatcgtc
aaactatgcccctccattcaggcaaaactagtctttttaaattttgtgcggctgccctat
ttcattgacttgaaaaggccacaagaccatggcttgaaccacacctttaacttctacctg
cagccagagactggtgtcaacattggtgtatggcacacagttccagaccagatgtggaaa
gaggcgcaggggaaggacagagagtggtatgacagtacctttaaatccccctatccagtc
atgctgtaccttcacggcaacgcagggacaagaggaggggaccatagagttcagctctac
aaggtccttagtttattaggctaccacgtagtcacattcgattacagaggttggggtgac
tcagacgggagcccctctgagagaggcatgacgtcagatgccctgttcctctaccagtgg
gtgaaggagagggtggggagcaaacccctcaacgtctggggccactcactggggacaggg
gtggccactaacctagtccgacatctgtgtgacagagggacgcccccaaactccttagtc
ttggaatctccgttcaccaacatccgagaggaggccaagagccaccccttctctatggtc
taccggtaccttccaggctttgaatggttctttttagataccatatcagcaaacgacatt
cgatttgccagtgacgaaaatgtggaccacatatcctgtccattgcttatccttcatgcc
gaggatgactcagtcgtgccctttaatctagggaagaagctgtacaacattgcttcccag
tccaagagcctgagtggacacaaacttcagttcatcccctttcctgtctctctggcctac
aagcacaagttcatctacaggagtcctgagctgccacacatactcagtgacttccttggc
acgactcatccacatgcataa

DBGET integrated database retrieval system