KEGG   Syntrophus aciditrophicus: SYN_00156Help
Entry
SYN_00156         CDS       T00346                                 

Definition
(GenBank) pyruvate:ferredoxin oxidoreductase delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat00010  Glycolysis / Gluconeogenesis
sat00020  Citrate cycle (TCA cycle)
sat00620  Pyruvate metabolism
sat00640  Propanoate metabolism
sat00650  Butanoate metabolism
sat00680  Methane metabolism
sat01100  Metabolic pathways
sat01120  Microbial metabolism in diverse environments
sat01130  Biosynthesis of antibiotics
sat01200  Carbon metabolism
Module
sat_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYN_00156
   00020 Citrate cycle (TCA cycle)
    SYN_00156
   00620 Pyruvate metabolism
    SYN_00156
   00640 Propanoate metabolism
    SYN_00156
   00650 Butanoate metabolism
    SYN_00156
  Energy metabolism
   00680 Methane metabolism
    SYN_00156
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SYN_00156
Enzymes [BR:sat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SYN_00156
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_21 Fer4 Fer4_6 Fer4_9 Fer4_2 Fer4_7 Fer4_10 Fer4_16 Fer4_17 Fer4_4 Fer4_13
Motif
Other DBs
NCBI-ProteinID: ABC75963
UniProt: Q2LYF1
Position
85078..85419
Genome map
AA seq 113 aa AA seqDB search
MMRYISLKSQIKVEVYRMAEKKWPEDWQEVNPGCIVFRPGSSRDYHTGTWRAERPVWDNS
RCIKCGLCYIFCPEGCISEDADGYFAADLNYCKGCGICAHECWPLAIKMVEEE
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atgatgaggtacatctcgcttaaatctcagataaaggttgaggtatatagaatggcggaa
aaaaaatggccagaagactggcaggaagtcaatcccggatgtatcgtctttcgacctgga
agctccagagactaccatacaggcacttggagggcggaacgcccggtctgggataattcc
agatgcatcaaatgcggcctctgctatatattctgccccgaaggctgcatttcggaagac
gcggatggatattttgcggcggatcttaattactgcaaggggtgcggtatctgcgcacat
gagtgctggcccctcgcgatcaagatggtggaggaggaatag

DBGET integrated database retrieval system