KEGG   Syntrophus aciditrophicus: SYN_00157Help
Entry
SYN_00157         CDS       T00346                                 

Definition
pyruvate:ferredoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
sat  Syntrophus aciditrophicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYN_00157
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYN_00157
   00020 Citrate cycle (TCA cycle)
    SYN_00157
   00620 Pyruvate metabolism
    SYN_00157
   00640 Propanoate metabolism
    SYN_00157
   00650 Butanoate metabolism
    SYN_00157
  Energy metabolism
   00680 Methane metabolism
    SYN_00157
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SYN_00157
Enzymes [BR:sat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SYN_00157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
84555..85100
Genome map
AA seq 181 aa AA seqDB search
MIEVRWHGRGGQGAVTSVELLALAAIGEGRYAQGFPSFGPERRGAPVEAFNRINDTRIKK
RQRIYRPDVVVVLDPGLISLVNVSEGLKPEGLLIINTSKSLKEIEKHIQFKGRIALVDAT
AIAWKELKVPITNTTMLGALVKMTDVVKLESLNEPIEHRFGRIANRNLAAMKLAYDEVHL
A
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagtgaggtggcatggaagaggcggacagggtgctgtgacatccgttgagctg
cttgcgctggcagcgatcggcgaaggccggtacgcgcagggatttccgagtttcggtcct
gaaaggcggggagcgccggttgaggctttcaaccggattaatgacacccggatcaagaag
cggcagcgtatttatcgtcccgatgtggtggtcgtcctggatcccggtttgatttccctg
gtcaacgtgtccgaggggctgaagccggaagggctcctgattatcaatacgagcaaatcc
ttgaaggagattgaaaaacacattcagttcaagggtcggattgctctggtcgatgcgaca
gccattgcctggaaggaactgaaggttcccattaccaacacgaccatgctgggcgcttta
gtcaaaatgacagatgttgtcaagctggaatccctgaatgagccgattgaacaccggttc
ggccggattgccaacaggaatctggcggccatgaagctggcctatgatgaggtacatctc
gcttaa

DBGET integrated database retrieval system