KEGG   Syntrophus aciditrophicus: SYN_00204Help
Entry
SYN_00204         CDS       T00346                                 

Definition
(GenBank) formamidopyrimidine-DNA glycosylase
  KO
K10563  formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:sat00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    SYN_00204
Enzymes [BR:sat01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     SYN_00204
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     SYN_00204
DNA repair and recombination proteins [BR:sat03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     SYN_00204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fapy_DNA_glyco H2TH zf-FPG_IleRS Zn_Tnp_IS1595 Auto_anti-p27 FbpA OrfB_Zn_ribbon Ribosomal_S13 zf-RRN7 zinc-ribbons_6
Motif
Other DBs
NCBI-ProteinID: ABC78980
UniProt: Q2LY20
Position
3113121..3114056
Genome map
AA seq 311 aa AA seqDB search
MLATLNGMAGFYAGRFCMRVDFLCRPAVTVKLEKSVSAPGWTDRTRKEEHMPELPEVETL
CRQLRQKVPHAKIKGTFILDSKLGKLDNLKGRGIASVTRLGKRIVLGLDDGRSLEIHLRM
TGRLLWQEKPDIGEKPPHSRFILDLTPGRIIIVDPRRFATLSLVADAAKGNAAVDALKPG
CPEALKEKGCNRSRSIKSFLMDQSIIGGIGNIYACEILYRAGLNPLRRTADLTSEDWRRV
GSAMVEVLSKAVVCRGTSISDWRDLFGCKGEYQKELRVYGREGKKCPHCGGIIQRVRLLG
RGTWFCPNCQA
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgctggcaactttgaatggaatggccggtttttacgcgggtcgcttctgcatgcgcgtc
gactttctctgccgccctgctgtcactgtcaaactcgaaaagagtgtgtcagcgcccgga
tggacagaccggacaagaaaagaggaacacatgcctgaactccccgaagtagaaaccctt
tgccgtcaactgcggcagaaagtacctcatgcaaagatcaagggaactttcatccttgac
agcaaactggggaagctggacaatctgaaaggccgcggcatcgcttccgtgactcgtctt
gggaaacggatcgtccttgggctggatgacggcagatcgctggaaattcacctgagaatg
acaggtcggcttctctggcaggaaaaaccggatatcggagaaaagccgccgcacagccgc
ttcatcctcgatctgacccccggtcggatcattatcgtcgatccccggcgttttgccacg
ttgtctcttgtcgcggatgcggcaaaggggaacgcggctgtcgacgccctgaagcccgga
tgcccagaggcactgaaagaaaagggatgcaaccgaagtcggtccattaaatcttttctc
atggaccagagcatcatcggcggaattggtaatatttatgcctgcgaaatcctctatcga
gcaggattgaatcctctccgcaggacggccgacctgacttcagaggactggcggcgcgtc
ggaagcgccatggttgaggtcctttcaaaggccgttgtttgccggggaacgtccatttcc
gactggcgcgatctttttggctgcaaaggcgagtatcagaaggaacttcgcgtatatggg
cgcgaggggaaaaagtgcccgcactgcggaggaatcattcagcgagtccgccttttgggt
cggggaacgtggttctgtccgaactgccaggcttga

DBGET integrated database retrieval system