KEGG   Syntrophus aciditrophicus: SYN_00295Help
Entry
SYN_00295         CDS       T00346                                 

Definition
glycogen debranching enzyme/alpha-amylase (EC:3.2.1.1)
Organism
sat  Syntrophus aciditrophicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2734824..2739095
Genome map
AA seq 1423 aa AA seqDB search
MNAILTQSPAPGKHLLRFCGDLVSFSLSVPAEMEGTAFVRTNLGHAHITRREIIRQVEYN
EPLLGRDWFDIPMKAVGPGRFEAVLALTEVGHFEAKCLFIPAGRPEPLWPPGNNTVINSE
PADTCCGNIIYNAFIRQFGPYKTMARAEAGPVDTIKTLDHAGYTVIPPSGTFRDLIAELD
FILNRLGCRILQLLPIHPTPTTYARMGRYGSPYASLSFTAVDAALAVFDPSATPVEQFLE
LVDGVHARHGKVIIDIAINHTGWAASLHESHPQWLARNEKGEIEAPGAWGVVWEDLTRLD
YSHKDMWAYMADVFLTWCRRGVDGFRCDAGYMVPVPAWRYIIAKVREQFPDTVFFLEGLG
GKISVTRELLSQGNFNWTYSELFQNYERNQIEWYLPETIEVSAGEGITVHFAETHDNPRL
AATSLTYARMRTALCALLAPHGAFGFANGVEWFAAEKINVHEPCALNWGAEENQVDAIAR
LNVILKTHPAFGPSVDLSLIGRGQGNFIALLRDHRNSGRKVIIVANLNCSATVTAQWHRS
HASFAGNSAVDLLTEENIPLQSSDSQTSGIDLAPGQVRCLTSPDDPWLAQSHLDPGVIPP
RVIRQRLRAKALEAMAGFSTELTMEPDAAAELLTADPSDFCRRLNRESDASRVVNWQFPS
DLRRQVMIPPGHFILFRADHPFRIRIIENGRIRATEQSLNDKNDRPFILLAPLKAQNGHK
LLTVEITRHTPQGSVHNTGTLLFLADGLDARVRTSFSRNDCHRMPLLALDTNGRGAMMRV
HADWWNLRSRYDALLAANLNPDFPEDRRILLTRCRAWVVFQGYSADVNLDCLARFGFDFQ
KGAWWRYRIPTGQGEHIVLQITLSMADDAANTVRLTARRLARIEAQQELDDSKPVTLIIR
PDIEDRNFHFTTKAFTGPEQSWPKAVSAGTDGLTFAPCPDYGLTMRIDSGRFVSEPEWYY
MVHRSLEAERGLDPDSDLFGPGYFTCELRGGAHVTLTARAQTGRAVSESSPKVPAFTVWT
PDEGGLSLEQALNSALEHYVVRRGNFRTVIAGYPWFLDWGRDTLIVVRGLVAAGQIETVK
DVLLQFARFEADGTLPNMIRGRDAGNRDTSDAPLWFFTACADLVAAEGHDHFLESDCNGR
TVRQVLADMATSIMTGTPNGIIMDPASGLLFSPAHFTWMDTNFPAGTPRQGYPIEIQALW
FAALKFLSRVHQEKRRWQDLADKVQAGIQALFWNPEAGYLADCRHAVPGQSALLAEPDDA
LRPNQLLALTLGAVSDPEIRRSVLKACGELLVPGAIRSLADRPVRLPLEIRHQGQLLNDP
WRPYWGRYSGDEDTRRKPAYHNGTAWTWLFPSFCEAWLDCYGPAEKATARSWLSSSLLLI
NSGCVGHVPEIADGDAPHTQRGCDAQAWGVSELLRVWKKLDSA
NT seq 4272 nt NT seq  +upstreamnt  +downstreamnt
atgaacgcgattcttacccaatccccagcgccggggaagcacctgctgcgcttctgcggc
gacctcgttagtttttcactcagtgtaccggcagagatggaagggacggcttttgtccgc
accaacctgggacacgcccatatcacccgcagggaaatcattcgccaggtggaatacaat
gagccccttctgggacgcgactggttcgacatccccatgaaggccgtggggcccggacgt
ttcgaagccgttctggcactcacggaagtcggccatttcgaagccaagtgcctgtttatc
cccgcaggtcgaccggaaccgctctggcctcccgggaacaatacggtcatcaactcggag
ccggctgacacctgctgcggaaatatcatctataacgccttcatccgccagttcggccct
tacaagacgatggccagggccgaggccggccccgtcgatacgatcaaaaccctggaccat
gccggatacaccgttatcccgccgtcgggaaccttccgggatctgatcgcggaactggat
tttatcctcaatcggctgggctgccgcattctccagcttctgcctattcaccccactccc
acgacgtatgcgcgaatgggacgatatggcagtccctatgcgtccctgagtttcaccgcc
gtggatgccgcgctggcggtttttgatccgtcagccacgcccgtggagcagtttctggaa
ctggtggacggggtccacgcccgccacggcaaagtgatcatcgatatcgcgatcaatcac
accggctgggcggccagcctgcatgaaagccatccccagtggcttgcccgcaacgagaag
ggggaaattgaagcccccggcgcctggggagtggtctgggaggacctgacccgcctggat
tacagccataaggacatgtgggcttacatggcggatgtctttctgacatggtgccgcaga
ggggtggacggcttccgttgcgacgcgggctacatggttcccgtaccggcctggcggtac
atcatcgccaaggtgcgggagcagtttcccgacaccgtctttttcctggagggtctgggt
gggaaaatttcggttacgcgagaactgctcagccagggcaatttcaactggacgtactcc
gagctgtttcagaattatgagcgcaatcagatcgagtggtatcttcccgaaacgatcgag
gtgtcggccggtgaagggatcacggtccatttcgccgaaacccacgacaacccgcgcctg
gccgccacatctctcacctacgcgcgcatgcgcacggccctgtgcgccctgctggcgcct
cacggggccttcggcttcgccaacggcgtggaatggttcgccgcggaaaaaatcaatgtc
cacgagccctgcgccctgaactggggagcggaagaaaaccaggtggatgccattgcccgg
ctgaatgtcatcctgaaaactcatcctgcctttggcccctccgtggatctgtcgctgatc
ggccgaggccagggaaacttcatcgccctgctgcgcgaccatcgaaattccgggcggaag
gttatcattgtagccaatctgaattgcagcgctacggtcaccgctcaatggcacagaagc
catgcctcctttgccggaaattcagcggtggatctgctcaccgaagagaatattcctttg
cagagttccgacagccagacctccggcatcgacctggcccccggtcaggttcgctgcctg
acttcgccggacgatccctggctggctcagtcccatctcgatcccggcgtcatccccccc
cgggtgatccgccagcgcctgcgtgccaaggcactggaagcgatggcgggtttcagcacg
gaacttaccatggagcccgatgctgcggcggagctcctgacggctgacccgtcagatttc
tgccgtcgtctcaatcgggaaagcgacgcttcgcgggtcgtgaactggcagtttccctcc
gatctgcgacggcaggtgatgatcccccccggtcacttcatcctcttccgcgccgatcat
cccttccgcatccgcattatcgaaaacggacgcattcgggccaccgaacagagcctcaac
gataaaaacgaccgtccgtttattctgctcgctcccctgaaagcacagaacggccacaag
ctgctgaccgtggaaatcacccgtcacactcctcaaggcagcgtccacaacaccggcacg
cttctttttctcgccgacggtctcgatgcgcgcgtccgcacatccttttcgcgcaatgac
tgccatcgaatgcccctgctggctctggataccaacggccgcggcgccatgatgcgggtg
catgccgactggtggaacctgcgaagccgctacgacgccctgctggccgccaatctgaat
cccgattttccggaagaccggcgaatcctgctgacccgctgccgggcctgggtcgtcttt
cagggatattccgcggacgtcaatctggattgtctggcccgcttcggttttgattttcaa
aaaggggcctggtggaggtatcgcatccccacggggcagggcgagcatatcgttctgcag
atcaccctctccatggccgatgacgcggccaacaccgtccggttgaccgcccggcgactg
gcccgcatcgaagctcagcaggagctggacgactcaaagccggttaccctgattatccgg
ccggacatcgaggaccgtaatttccacttcaccaccaaagccttcaccggcccggaacag
agctggccgaaagcggtcagcgccggcacagacggactcacctttgccccctgtccggat
tacggccttactatgcggatcgactcgggccgtttcgtcagcgaaccggaatggtactat
atggtccaccgctccctggaggccgagcggggtctggacccggacagcgacctcttcggc
cccggctacttcacctgcgaattgcggggcggcgctcatgtcaccctgaccgcccgggca
caaaccggccgggcagtttcagaatcgtccccgaaagtgcccgccttcaccgtctggacg
cccgacgaaggcggattgtctctggagcaggcgctgaactccgccctggaacactatgtg
gtgcgccggggaaacttccgcacggtaatcgccggatatccctggtttctcgactgggga
cgggacaccctgatcgttgttcgcggcctggtggctgcgggacagatcgaaacggtcaag
gacgttttactccagttcgcccgttttgaggccgacgggacccttcccaacatgattcgc
ggcagggatgcaggcaaccgcgacacctcggacgcccccttgtggtttttcactgcctgc
gcggacctggttgcggccgaaggccatgatcatttcctggaaagcgactgcaacggacga
accgtccgtcaggtcctggcggacatggcgacgtccatcatgacgggaacgcccaacggc
atcatcatggatcccgcctcgggcctgcttttcagcccagcgcactttacctggatggat
accaatttcccggccggcaccccccggcagggctatcccattgagattcaggccctctgg
tttgcggccctgaaatttctttcccgcgttcatcaggaaaaacggcgctggcaggatctg
gccgataaagttcaggccggcattcaagccctcttctggaatcccgaagcaggttatctg
gcggactgccgtcacgccgttcccggacagagcgcgcttctggccgaacccgacgacgcc
ctgcgccccaatcagctgctggccctcaccctgggggcggtcagcgacccggaaatccgc
cgctcggtcctgaaagcctgcggggagctgctcgttcccggagccatccgcagcctggcc
gaccgtcccgtgcggctgcccctggaaatccgccatcaggggcagcttctcaacgatccc
tggcgcccctactggggccgctactccggtgacgaagatacgcgccgcaaaccggcctat
cacaacggcacagcctggacatggctcttcccttccttctgcgaagcctggctggactgc
tacggtcccgccgaaaaggcgaccgcccgatcctggctgtccagcagccttctgctgatc
aacagcggctgcgtgggtcacgtcccggaaatcgcggacggcgacgccccccatacccag
cgaggctgcgatgcccaggcctggggagtcagtgaactgctgcgggtttggaaaaaactg
gattcggcttga

DBGET integrated database retrieval system