KEGG   Syntrophus aciditrophicus: SYN_00647Help
Entry
SYN_00647         CDS       T00346                                 

Definition
acetyl-CoA synthetase (EC:6.2.1.13)
Organism
sat  Syntrophus aciditrophicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2137069..2138517)
Genome map
AA seq 482 aa AA seqDB search
MVFLPQLPHNNKEEIKHMMTQKLVKLFSPDSVAVIGASNSFDKLGYHVMKSLVGHYAGKI
YPINLKGGKVWNLDSYASLAEVPGNIDLAIIVVPAALVPETLHQCGGKGVKGAVLITAGF
REIEDSQGGVLQERIRKICDQYEMPIIGPNTSGFANIAFGIDASFTSEFCELEKGGVAII
SQSGGLCHLCGFLALHQRMGVSSLMSLGNRLNVGFPEAVRFFIEEDEATKVIALYIEGLD
EPRELLDMARSLRGKKPIVAYKSGKSAKSDSASKFHTGSLAGNHEIWKGAFRQAGILEVT
SSEELIDTAKVLDSCALARGNRITVLSGQAGPGIIAADALEAYGLSLSQFSAATKEKINE
YLPPIVIRTNPVDMGPVWYNPKAMFDILNAVIEDEGTDGVIFINLYASANLSLASAMAEH
IKNIDAFKKPVIGVITAPPGVWDDGIKRLDRKKGIAILPTPERAAKAMSNLWKANLLSAR
GK
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
gtggtttttctcccccagcttccacacaacaataaggaggaaataaaacatatgatgacg
caaaaactggtgaagcttttttctcccgactcggtagcggtcataggggcgtcgaacagt
tttgacaaacttggttatcacgtaatgaagagccttgtcggccattatgcgggcaaaata
taccccatcaatctgaaagggggaaaggtgtggaaccttgactcttatgcgtccctagca
gaagtcccggggaacatcgaccttgcgatcattgtggtgcctgccgctcttgtgcctgag
acattacatcagtgcgggggaaagggagtcaaaggggcagtgcttataactgcgggtttc
cgggaaattgaagactcgcagggaggagtccttcaggaacggattcgcaaaatatgcgat
caatacgagatgccgatcatcggccccaatacatccggttttgccaacattgccttcggg
attgatgcctctttcacctctgagttctgtgaattggaaaagggcggcgtagccatcata
agccagagcggaggactatgccacttgtgtgggtttctggcccttcatcagagaatggga
gtatcgtcattgatgagcctcggaaatcggctcaacgtgggtttcccggaagccgtgcgg
ttctttattgaagaagacgaggccactaaggtcattgccctttacatagagggcctcgat
gaaccgagggaactccttgacatggccagatcgttgagagggaaaaaacccatcgtcgcc
tataaatctggaaaaagcgcaaaaagcgatagtgcaagcaaattccacaccggctccctt
gccggcaatcatgagatttggaaaggcgcttttcgtcaggcggggattctggaggttacg
tcctcagaggaattgattgacacggcaaaagtgctcgattcctgcgctctcgcccgggga
aatcgcattacggttctttccggccaggcaggtcctggaatcatagcagcagatgccctg
gaagcatatggattaagtctctcgcagttctctgcggcaacgaaggaaaagatcaatgag
tatcttccacccattgtcatccgcaccaatccggttgacatgggtcctgtgtggtacaat
ccgaaagccatgttcgatatcctcaatgcagtgatcgaggatgaaggcacagatggcgtc
atctttatcaacctgtatgcgtcagcgaatctttccctggcatctgcgatggcagagcac
attaagaatatcgatgcttttaaaaaaccggtaattggtgttattacagcgccccccggg
gtttgggacgacgggataaaaaggctcgacaggaaaaagggtatcgcaatccttcctacg
cctgaacgtgccgcgaaagccatgagcaatctttggaaagccaatctattgtcagcaagg
gggaagtaa

DBGET integrated database retrieval system