KEGG   Syntrophus aciditrophicus: SYN_00691Help
Entry
SYN_00691         CDS       T00346                                 

Definition
pyruvate synthase subunit (EC:1.2.7.1)
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
sat  Syntrophus aciditrophicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:sat01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sat00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:sat00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sat00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sat00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:sat00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:sat00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2179913..2180827
Genome map
AA seq 304 aa AA seqDB search
MSLSFLDGRWILKMDIPSEEYLLKCSSSCAGCSDSLTLRYVLKAAGPDTVLIVPACCTSV
IQGMYPQTAFNVPVYNIAFGAAAACASGMSNALRALGRKTSVIVYAGDGGTLDIGIQALS
GAFERGTDFLYICYDNEAYGNTGMQRSGATPLGARTTTTPSGKMDVKKDIDAIVAAHSPP
YMATACPAYPRDLFQKVRKALMFRGPSFLHVLAPCPPGWRFSPEKSVELGKLAVKSCMWV
LYEREHGKLSLSSPSRTAMKKPIPLEEYLAPQGRFEGINAETLEALKQNIAESIKRLTAE
EAGG
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
gtgtctctctcattccttgacggaagatggatactgaaaatggacatccccagcgaagaa
tacctgcttaagtgctcatcctcgtgtgccggatgcagcgactctcttaccctgcgttac
gtgctcaaggcagcgggacctgatacggtcctgatcgtgccggcctgctgcacgagtgtg
attcagggcatgtacccgcaaacggcattcaacgttcccgtatataacatcgctttcggg
gccgccgctgcctgcgcttccggcatgtcgaacgccctccgcgccctgggcagaaagacc
agcgtgatcgtttacgccggtgacggcggcacactcgatatcgggatacaggctctttcc
ggcgcctttgaaagaggcactgattttttatatatctgctacgacaacgaagcatacgga
aataccggcatgcagcgctccggagcaacccccctcggcgcccggacaacaacgaccccc
tcaggaaaaatggatgtaaaaaaagacatcgacgcgattgtcgcggcccacagcccgccc
tacatggcaacggcctgtcccgcatacccccgggatctcttccagaaagtccggaaagca
ctcatgttccggggcccatcctttcttcacgtgcttgccccctgccctcccggctggcgt
ttctcaccggaaaagtccgttgaattgggaaaactcgccgtaaaatcctgcatgtgggtg
ctttacgaacgcgagcacggcaaactgtccctctcctcaccttccagaacagccatgaaa
aagccgattcctctcgaagaatatctggcgcctcagggtcgcttcgagggaattaacgcg
gaaacacttgaagctctcaagcagaacatcgcagagagcataaaaaggctgacagcagag
gaggcgggaggatga

DBGET integrated database retrieval system