KEGG   Syntrophus aciditrophicus: SYN_00692Help
Entry
SYN_00692         CDS       T00346                                 

Definition
pyruvate synthase subunit alpha (EC:1.2.7.1)
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
sat  Syntrophus aciditrophicus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYN_00692
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYN_00692
   00020 Citrate cycle (TCA cycle)
    SYN_00692
   00620 Pyruvate metabolism
    SYN_00692
   00640 Propanoate metabolism
    SYN_00692
   00650 Butanoate metabolism
    SYN_00692
  Energy metabolism
   00680 Methane metabolism
    SYN_00692
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SYN_00692
Enzymes [BR:sat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SYN_00692
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2180824..2181936
Genome map
AA seq 370 aa AA seqDB search
MKTIATGNKAVAEAVKQAQPTVIAAYPITPQTQIIEQIAEYVASGKLKSRFIPVESEHSA
MAACIGASVTGVRTFTATSSQGLLYMHEMTNWAAGARLPIVMANVNRAISPGWNIWAEHT
DSMQERDTGWLQVYAGSVQEAYDATLMAFRIAEHEDVLLPVMVNLDGFALSHISQPLDPV
EIGDFLPPMFLPHAIDTQNPAGYGVLTGPDDYFKFRWDIERSMRDSVKVIESVQEDYARR
FGRCYGFTEDYCCDDANVVVISMGTLGKEAEVAIDMLRSEGIRAGSLRLRWLRPFPEINL
EGREIVVIDRAYSFGFGGILATSIRSRIKRDLYSVIAGLGGQEVTYEDIADFIRQRRIGE
ECWFGVNDHA
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgattgcaaccggcaacaaggcagtagctgaagctgtcaaacaggcccagccc
acagtgatcgccgcctacccgattaccccgcagactcagattattgagcagattgcagag
tatgtcgcctcaggaaagctgaagagccgtttcatccccgtggaaagcgaacactccgcg
atggcggcgtgcatcggggccagcgttaccggagtccggacgttcacggcaaccagttcc
cagggcctgctctacatgcatgaaatgacaaactgggcggcaggcgcccgtcttcccatt
gtcatggccaacgtgaaccgggccatatctcccggatggaacatctgggccgagcatacg
gattccatgcaggagcgggataccggctggcttcaggtctatgcgggcagcgtgcaggag
gcctatgatgcgacactgatggctttccgcattgccgagcacgaggatgtcctgcttccc
gtgatggtcaaccttgacggattcgctttaagccacatttctcagccgctggacccggtc
gagatcggagattttctcccgccgatgttccttccccatgccatcgatacccaaaacccc
gccggttatggggtgctgaccggccctgacgattacttcaaattccgctgggacatcgaa
cgctccatgcgggactcggtcaaggttattgaatccgtgcaggaagattatgcccgtcga
ttcggccggtgctatggcttcacggaggattactgctgtgatgacgcgaacgtcgtcgtg
atttcaatgggaacactgggcaaggaagccgaagtggccatcgacatgctccgcagtgag
gggattcgagccggctctctgcgcctgcgctggctgcgtccgttcccggaaatcaacctc
gaaggtcgggagatcgtcgtgatcgaccgggcttactctttcggcttcggaggcatcctg
gccacatccatccgatcccggataaaaagggacctttacagcgtgatcgccggtctcggg
ggacaggaagttacgtatgaagatatcgccgatttcatccgtcagcgtcgtatcggtgag
gaatgctggttcggggtgaacgaccatgcttga

DBGET integrated database retrieval system