KEGG   Syntrophus aciditrophicus: SYN_00693Help
Entry
SYN_00693         CDS       T00346                                 

Definition
(GenBank) pyruvate synthase gamma chain
  KO
K00172  pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat00010  Glycolysis / Gluconeogenesis
sat00020  Citrate cycle (TCA cycle)
sat00620  Pyruvate metabolism
sat00640  Propanoate metabolism
sat00650  Butanoate metabolism
sat00680  Methane metabolism
sat01100  Metabolic pathways
sat01120  Microbial metabolism in diverse environments
sat01130  Biosynthesis of antibiotics
sat01200  Carbon metabolism
Module
sat_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYN_00693
   00020 Citrate cycle (TCA cycle)
    SYN_00693
   00620 Pyruvate metabolism
    SYN_00693
   00640 Propanoate metabolism
    SYN_00693
   00650 Butanoate metabolism
    SYN_00693
  Energy metabolism
   00680 Methane metabolism
    SYN_00693
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    SYN_00693
Enzymes [BR:sat01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     SYN_00693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR
Motif
Other DBs
NCBI-ProteinID: ABC77988
UniProt: Q2LV76
Position
2181929..2182456
Genome map
AA seq 175 aa AA seqDB search
MLEIRIHSRGGQGGVTGARLLALAAIHDGKYATASVFYGPQRRGAPVMSFVRIDDRPIRI
YSRIKEPDMVVILDASVMDMVNVLQGLKQGGRIFINSVEAKDFPGFSTCHADLTGIAQKE
NIIVAGYTILNTPMLGCLAKMGIISLDSARKSILEMFPDECNVRAAEAGYREMKL
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgcttgagatccgcatccactcccggggcggccagggtggggtgacaggggcaaggctt
cttgccctggcagcgatccatgacgggaagtacgcaacggccagcgtcttctacgggccg
caacgccggggggcgcccgtcatgtccttcgtccggatagatgatcgcccgatcaggatc
tacagtcgcatcaaggaacccgatatggtcgtaatcctggatgcgagcgtgatggatatg
gtcaatgtgctgcagggtttgaaacagggcggcaggatattcatcaacagcgttgaagca
aaagatttccccggtttttccacttgtcacgcagacctgaccggaatcgcgcagaaggaa
aatatcatcgttgccggctatacgattttgaacacacccatgctcgggtgtctcgcaaag
atggggattatctcgctggattcggcaagaaagtcgattctggagatgtttcccgatgaa
tgcaacgtcagggctgcagaagcaggatatcgagagatgaaactatga

DBGET integrated database retrieval system