KEGG   Syntrophus aciditrophicus: SYN_00886Help
Entry
SYN_00886         CDS       T00346                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat00010  Glycolysis / Gluconeogenesis
sat00030  Pentose phosphate pathway
sat00051  Fructose and mannose metabolism
sat00052  Galactose metabolism
sat00680  Methane metabolism
sat01100  Metabolic pathways
sat01110  Biosynthesis of secondary metabolites
sat01120  Microbial metabolism in diverse environments
sat01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYN_00886
   00030 Pentose phosphate pathway
    SYN_00886
   00051 Fructose and mannose metabolism
    SYN_00886
   00052 Galactose metabolism
    SYN_00886
  Energy metabolism
   00680 Methane metabolism
    SYN_00886
Enzymes [BR:sat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SYN_00886
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SYN_00886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABC77502
UniProt: Q2LTU1
Position
complement(1674233..1675447)
Genome map
AA seq 404 aa AA seqDB search
MLKASRKQMARARQGTEEYYQFIYLTSEFINHGRLLMKMKIAVLTGGGDCPGLNGAVKWV
TKSATDQWLGSKRSMSFEVIGITDGWRGLVDVDPDDPKSLAKYTRPLDEEIVRTWDRYGG
TNLGTSRTNPFNPKNDRSEILLDNIKKLGIDVVVAIGGEDTLGAAYSLHKLGIKTVGIPK
TIDNDLVGTDYSIGFDTAVNVITEEIDRLRTTAGSHSRIFVVETMGRHAGWLALHGGECS
GAYIILIPEHPFNLDEICTLLQERKGREIRYAILVVSEGAKPVGQKEFITSSKIDEFGHV
ALGGIAKFVADEIEGRTSLETRHLILSHLQRGGTPSAHDRLMARWFGIAAVDMIINEDFG
RMASLQRGEITSVPLKECIGKLKLVDTVKYYDKERYNGRRSIIS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagcttcacgcaaacagatggcccgcgccaggcaaggcacagaggaatattac
caatttatttatttgacaagtgaattcataaatcatgggaggctgcttatgaaaatgaaa
attgctgtactgacaggcggtggtgattgtcccggtttgaacggcgcggtaaaatgggtt
acaaaaagtgcaacagatcaatggttgggatcaaaacgttccatgtcattcgaagtcatt
gggattacggatggatggcgtggactggttgatgttgatccggacgatcccaaaagcctg
gcaaaatacactcgtcctcttgatgaagaaatcgttcggacgtgggaccgttatggaggg
actaacctcggaacttcacgcaccaatcctttcaatcccaaaaatgacagatcggaaata
ttactggataatattaaaaaactcggaattgatgtagttgtcgccatcggaggggaagat
actctgggggcggcttacagtctgcacaaactgggaatcaagaccgttggtattcctaag
acaattgataacgacttggttggaacggattattctattggattcgacactgccgtcaat
gtgattacggaagaaatcgaccgtctgcggacgacagccggttcacacagccggattttc
gttgtggaaaccatgggacgtcacgccggatggcttgcacttcatggcggtgaatgcagt
ggcgcctatatcattcttattcctgaacatccatttaatctcgatgaaatatgcacgctg
ctccaggaaagaaaaggaagggaaatccgctatgccattcttgttgtctctgagggagcg
aagccggtcggtcagaaagagtttatcacaagttccaaaatagatgaattcggccatgtc
gctcttggggggatagccaaattcgtcgctgatgaaattgaaggaagaacgagtctggag
accagacacttaatccttagtcatttgcagcgcggcggtacaccatcagcccatgacaga
ctgatggcaagatggtttggaatcgctgcggtggatatgattattaatgaagattttggc
cgtatggcaagcctgcagcggggtgaaattaccagtgttcctctgaaggaatgcatcgga
aaattaaaacttgtggatactgtaaagtattacgacaaagaacgatataatggacgtcga
tccataatcagttaa

DBGET integrated database retrieval system