KEGG   Syntrophus aciditrophicus: SYN_00886Help
Entry
SYN_00886         CDS       T00346                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sat  Syntrophus aciditrophicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYN_00886
   01230 Biosynthesis of amino acids
    SYN_00886
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYN_00886
   00030 Pentose phosphate pathway
    SYN_00886
   00051 Fructose and mannose metabolism
    SYN_00886
   00052 Galactose metabolism
    SYN_00886
  Energy metabolism
   00680 Methane metabolism
    SYN_00886
Enzymes [BR:sat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SYN_00886
Protein phosphatases and associated proteins [BR:sat01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SYN_00886
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1674233..1675447)
Genome map
AA seq 404 aa AA seqDB search
MLKASRKQMARARQGTEEYYQFIYLTSEFINHGRLLMKMKIAVLTGGGDCPGLNGAVKWV
TKSATDQWLGSKRSMSFEVIGITDGWRGLVDVDPDDPKSLAKYTRPLDEEIVRTWDRYGG
TNLGTSRTNPFNPKNDRSEILLDNIKKLGIDVVVAIGGEDTLGAAYSLHKLGIKTVGIPK
TIDNDLVGTDYSIGFDTAVNVITEEIDRLRTTAGSHSRIFVVETMGRHAGWLALHGGECS
GAYIILIPEHPFNLDEICTLLQERKGREIRYAILVVSEGAKPVGQKEFITSSKIDEFGHV
ALGGIAKFVADEIEGRTSLETRHLILSHLQRGGTPSAHDRLMARWFGIAAVDMIINEDFG
RMASLQRGEITSVPLKECIGKLKLVDTVKYYDKERYNGRRSIIS
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaagcttcacgcaaacagatggcccgcgccaggcaaggcacagaggaatattac
caatttatttatttgacaagtgaattcataaatcatgggaggctgcttatgaaaatgaaa
attgctgtactgacaggcggtggtgattgtcccggtttgaacggcgcggtaaaatgggtt
acaaaaagtgcaacagatcaatggttgggatcaaaacgttccatgtcattcgaagtcatt
gggattacggatggatggcgtggactggttgatgttgatccggacgatcccaaaagcctg
gcaaaatacactcgtcctcttgatgaagaaatcgttcggacgtgggaccgttatggaggg
actaacctcggaacttcacgcaccaatcctttcaatcccaaaaatgacagatcggaaata
ttactggataatattaaaaaactcggaattgatgtagttgtcgccatcggaggggaagat
actctgggggcggcttacagtctgcacaaactgggaatcaagaccgttggtattcctaag
acaattgataacgacttggttggaacggattattctattggattcgacactgccgtcaat
gtgattacggaagaaatcgaccgtctgcggacgacagccggttcacacagccggattttc
gttgtggaaaccatgggacgtcacgccggatggcttgcacttcatggcggtgaatgcagt
ggcgcctatatcattcttattcctgaacatccatttaatctcgatgaaatatgcacgctg
ctccaggaaagaaaaggaagggaaatccgctatgccattcttgttgtctctgagggagcg
aagccggtcggtcagaaagagtttatcacaagttccaaaatagatgaattcggccatgtc
gctcttggggggatagccaaattcgtcgctgatgaaattgaaggaagaacgagtctggag
accagacacttaatccttagtcatttgcagcgcggcggtacaccatcagcccatgacaga
ctgatggcaagatggtttggaatcgctgcggtggatatgattattaatgaagattttggc
cgtatggcaagcctgcagcggggtgaaattaccagtgttcctctgaaggaatgcatcgga
aaattaaaacttgtggatactgtaaagtattacgacaaagaacgatataatggacgtcga
tccataatcagttaa

DBGET integrated database retrieval system