KEGG   Syntrophus aciditrophicus: SYN_00887Help
Entry
SYN_00887         CDS       T00346                                 

Definition
diphosphate--fructose-6-phosphate 1-phosphotransferase (EC:2.7.1.90)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
sat  Syntrophus aciditrophicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYN_00887
   01230 Biosynthesis of amino acids
    SYN_00887
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYN_00887
   00030 Pentose phosphate pathway
    SYN_00887
   00051 Fructose and mannose metabolism
    SYN_00887
   00052 Galactose metabolism
    SYN_00887
  Energy metabolism
   00680 Methane metabolism
    SYN_00887
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    SYN_00887
Enzymes [BR:sat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SYN_00887
Protein phosphatases and associated proteins [BR:sat01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     SYN_00887
Messenger RNA biogenesis [BR:sat03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     SYN_00887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1672743..1674134
Genome map
AA seq 463 aa AA seqDB search
MRHGRINGFMKKVQQEDYIIQNLGECAIQSPVIVNDFTPDSKRLLLKQYLDYSNTGKNKD
EKVKREIPLSVEVAGPREKIFFDPSKTKAAIVTCGGLCPGINDVIRAIVMQLYHRYGVRN
IIGIKYGFQGLIPSYGHEIVELTPESVENIHREGGSILSSSRGQQNIGEMVDALSRMNVN
IFFCIGGDGTMRAAERITEEITRRKLSISLIGIPKTIDNDLNFVQKTFGFDTAIAESENA
ISCAHVEAKGAPMGIGLVKIMGRLSGQIAVGAALAQNDVNFVLIPEVPFDLEGENGLFKA
LEKRLIRRKHCVILVAEGAGQELMRTNNTPQETDASGNIRLLDIGYFLKVRIEDYFKKAG
IQINLKYIDPSYMIRSVRASASDSIYCSALGQYAVHAGMAGKTGMLVGLLKDEYVHLPIR
VVTSGKQIDPEGNLWMRVLESTGQPPSLLNKPLDPPVEEHVVI
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
ttgcggcacgggaggattaatggtttcatgaaaaaagttcagcaggaagattatattata
caaaacttgggtgaatgtgcgatccagtctccggtaatcgttaatgattttacgcccgac
agcaagcgtttgctgctgaaacaatatcttgactatagtaataccggaaaaaataaggac
gaaaaagtgaaaagggagattcccctttctgtggaagtggcaggtccacgggaaaaaata
tttttcgatccttccaaaacaaaagcggcgattgtcacttgcggcggcttgtgcccggga
atcaatgacgtgattcgcgccatcgtcatgcaattatatcaccgttacggtgttcgcaac
ataattggaataaagtatggattccaaggacttataccatcatacggacatgaaattgtt
gaattgacgcctgaatcggttgaaaatatccatcgcgaaggtggcagtatattatcttcc
tcacgaggtcagcagaatattggagaaatggttgacgccctttcgcgaatgaatgtcaat
atttttttctgtatcggcggtgatggaaccatgcgcgcggctgaacgcattacagaggaa
attacaagacgaaaattaagcataagcctaatcggtatcccgaaaacgatcgataacgat
ctgaattttgttcagaaaacattcgggtttgatacagcaatcgctgaatccgaaaacgca
atctcctgcgcccatgttgaagcgaaaggtgcgcctatgggaataggactcgtcaagatt
atgggacggctctccggtcagatcgctgttggtgcggcactggcacagaatgacgtcaat
tttgtcctgattcccgaagtaccttttgatcttgaaggcgaaaacggcctcttcaaagcc
ttggaaaaacgtctcatacgcagaaaacattgtgttattcttgtggcagaaggcgccggt
caggaactgatgcgcacaaataatacgcctcaggaaacagatgcttccggcaatatccgt
ctgctggatatcggctattttttaaaggtgcggattgaagactactttaaaaaagcgggc
atccagatcaatctgaaatatattgaccccagctatatgattcgcagtgttcgcgcaagt
gccagcgacagtatctattgctccgctcttggccagtacgccgttcatgccgggatggcc
ggaaaaaccgggatgctggtcggtttattgaaagatgaatatgtccacttgccaatccgg
gttgttacttcagggaaacagatcgatccggaaggcaatttatggatgcgggttcttgaa
tcgacgggtcagcctccttccttgcttaataaacctttggaccctcctgttgaggaacat
gttgttatttga

DBGET integrated database retrieval system