KEGG   Syntrophus aciditrophicus: SYN_00964Help
Entry
SYN_00964         CDS       T00346                                 

Definition
protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sat  Syntrophus aciditrophicus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:sat00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SYN_00964
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    SYN_00964
Enzymes [BR:sat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     SYN_00964
Two-component system [BR:sat02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   SYN_00964
Bacterial motility proteins [BR:sat02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    SYN_00964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1214354..1215385
Genome map
AA seq 343 aa AA seqDB search
MSKIKVLVVDDSAIVRKIFTEELSKYPDIEVVGSAPDPFVARDKIVHLKPDVITLDIEMP
RMDGLTFLKKLMRHYPLPAIIVSSLTPKGGKLTLEAMDIGAVDAIAKPGSSYSVGDMSGQ
LVEKIRAASGARVVRKSTQEMFQPGSRLSIRSLAETSNKVIAIGASTGGTEALKNVLSRM
PPDSPGILVVQHMPANFTTAFAERLNSLCQIGVKEAADNDSVTPGTALIAPGNYHMILRR
SGARYYVQIKMGPMVHHQRPAVDVLFKSTAKYAGANAIGVILTGMGADGAAGLLEMKQMG
AGTIAQNEKSCIVYGMPKEAVKIGAVDKIVHLDSIADEIVRMV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagataaaggtcttggttgttgatgattcggcgattgtcagaaaaatttttacc
gaagagctctcgaaatatccagatatagaagttgtcgggtcggccccggatccttttgtg
gcccgcgacaaaattgtccatctgaaaccggatgtgattacgctggacatagaaatgcca
aggatggatggtttgaccttcctgaaaaagctgatgagacattaccctcttcccgcaatt
atcgtcagttccctgacccccaaaggggggaaactgacccttgaggctatggatatagga
gcggtcgatgctatcgctaagccaggaagttcatactctgtaggtgatatgagcggacag
ttggttgaaaagatccgagcggcatcaggggcaagagttgtgaggaagagcacacaggaa
atgtttcagcccggctcacgtctttccataagatctcttgctgaaacttcgaataaagtt
attgccattggcgcatcgacaggcgggacggaagctctgaaaaacgtgctttccaggatg
cctcccgattcacctggaattcttgtagtgcagcatatgccggcgaacttcaccacggcc
ttcgcggaacgcttgaacagtctttgtcaaattggcgttaaagaagccgcggataacgat
tcggtaactcccggaacagcgcttatcgcaccgggaaactatcacatgattctacggcgg
agtggcgcacgatattatgttcaaataaaaatgggtcccatggtgcatcatcaaaggccg
gctgtggacgttctttttaaatcaacggctaaatatgcaggggctaatgccatcggtgtc
attttgaccgggatgggcgccgatggtgctgcgggacttctggaaatgaagcagatggga
gcaggcacgatcgcgcagaatgaaaaatcctgtattgtttatggaatgcccaaggaagcc
gtgaaaataggggcggttgataaaatcgttcatcttgattcgattgctgatgaaattgtg
aggatggtgtag

DBGET integrated database retrieval system