KEGG   Syntrophus aciditrophicus: SYN_00964Help
Entry
SYN_00964         CDS       T00346                                 

Definition
protein-glutamate methylesterase CheB (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sat  Syntrophus aciditrophicus
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sat02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sat02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1214354..1215385
Genome map
AA seq 343 aa AA seqDB search
MSKIKVLVVDDSAIVRKIFTEELSKYPDIEVVGSAPDPFVARDKIVHLKPDVITLDIEMP
RMDGLTFLKKLMRHYPLPAIIVSSLTPKGGKLTLEAMDIGAVDAIAKPGSSYSVGDMSGQ
LVEKIRAASGARVVRKSTQEMFQPGSRLSIRSLAETSNKVIAIGASTGGTEALKNVLSRM
PPDSPGILVVQHMPANFTTAFAERLNSLCQIGVKEAADNDSVTPGTALIAPGNYHMILRR
SGARYYVQIKMGPMVHHQRPAVDVLFKSTAKYAGANAIGVILTGMGADGAAGLLEMKQMG
AGTIAQNEKSCIVYGMPKEAVKIGAVDKIVHLDSIADEIVRMV
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagataaaggtcttggttgttgatgattcggcgattgtcagaaaaatttttacc
gaagagctctcgaaatatccagatatagaagttgtcgggtcggccccggatccttttgtg
gcccgcgacaaaattgtccatctgaaaccggatgtgattacgctggacatagaaatgcca
aggatggatggtttgaccttcctgaaaaagctgatgagacattaccctcttcccgcaatt
atcgtcagttccctgacccccaaaggggggaaactgacccttgaggctatggatatagga
gcggtcgatgctatcgctaagccaggaagttcatactctgtaggtgatatgagcggacag
ttggttgaaaagatccgagcggcatcaggggcaagagttgtgaggaagagcacacaggaa
atgtttcagcccggctcacgtctttccataagatctcttgctgaaacttcgaataaagtt
attgccattggcgcatcgacaggcgggacggaagctctgaaaaacgtgctttccaggatg
cctcccgattcacctggaattcttgtagtgcagcatatgccggcgaacttcaccacggcc
ttcgcggaacgcttgaacagtctttgtcaaattggcgttaaagaagccgcggataacgat
tcggtaactcccggaacagcgcttatcgcaccgggaaactatcacatgattctacggcgg
agtggcgcacgatattatgttcaaataaaaatgggtcccatggtgcatcatcaaaggccg
gctgtggacgttctttttaaatcaacggctaaatatgcaggggctaatgccatcggtgtc
attttgaccgggatgggcgccgatggtgctgcgggacttctggaaatgaagcagatggga
gcaggcacgatcgcgcagaatgaaaaatcctgtattgtttatggaatgcccaaggaagcc
gtgaaaataggggcggttgataaaatcgttcatcttgattcgattgctgatgaaattgtg
aggatggtgtag

DBGET integrated database retrieval system