KEGG   Syntrophus aciditrophicus: SYN_01000Help
Entry
SYN_01000         CDS       T00346                                 

Definition
protein-L-isoaspartate o-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sat  Syntrophus aciditrophicus
Brite
Enzymes [BR:sat01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SYN_01000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2053449..2054105)
Genome map
AA seq 218 aa AA seqDB search
MMDRFQKQRLRMVDTQIRARGVLNPRILEAMSRIPRHLFVEEALADQAYNDNPLPIGDMQ
TISQPYIVALMTDALDLKGREKVLEIGTGSGYQTALLAELADQVFSIERIASLANNARRI
LDQLGYYNVAIRIGDGTYGWKEESPFDAILVTAGAPDIPMPLIEQLKIGGRLVLPVGGRH
IQDLVKVTRLSEDINELKKENLGGCRFVDLIGEYGWSG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgatggaccgatttcaaaaacagcgattgcgaatggtggatacccagatccgggcaaga
ggagttttaaatccccgcattctggaggcgatgtccagaattccccgtcatctcttcgta
gaagaggcccttgccgatcaggcatataacgataaccctctgcccatcggcgatatgcag
acgatttcgcagccttacattgtagcgctgatgacggatgccctggatctcaagggcagg
gaaaaagtattggagattggtacgggttcaggatatcagaccgccctgctggccgaactg
gcggatcaggtattttccatcgaaaggattgcgtcactggccaacaacgcccgtcgcata
ctcgatcagctgggttattataatgtggcgatacgaatcggggacggcacctatggctgg
aaagaggaatctccttttgatgcgattctggttacagcgggtgcacctgatatccccatg
ccactgattgaacaattgaagatcgggggccgactggtcctgcccgtagggggaaggcat
attcaggatctcgtgaaagttacgagactgtctgaggacatcaatgagttaaagaaagaa
aatctgggaggctgccgctttgtagatcttatcggagagtatggctggtccggctga

DBGET integrated database retrieval system