KEGG   Syntrophus aciditrophicus: SYN_01147Help
Entry
SYN_01147         CDS       T00346                                 

Definition
arginase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
sat  Syntrophus aciditrophicus
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SYN_01147
Enzymes [BR:sat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     SYN_01147
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
378267..379340
Genome map
AA seq 357 aa AA seqDB search
MANAGASVCWTVVADELNRIRGISMNRKNVPMVANRKGSLPRVYGDTPSFLGVDVVDINR
LEKGRDVIFSGVPWEGTVTWGSFSGCELAPRAIRHSAARYGGFLPEYELDFFDYLTVADA
GDVSVDPNSPEKTMNNIYSSMDRIYGKGSIPVTVGGDHSITPPIVDALGNNAKGPIGILH
FDAHLDNAKVFGEDLFARCSPLHRIAQNEKVRTESIVHIGIRGPRNSPSQLEYAWQIGAR
VFNIREIRERGMTSVIDEALRIASNQTEHVYVTICSDCIDASFNPGGPADFNGLFPHELF
SALYTIGRAGISGLDYVEVYPIQDPNSFSSHLASWAIIHALVGLASGKKKKSETATA
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaatgccggggcttcggtttgctggactgttgtcgccgatgaactgaatcgaata
agggggatatccatgaatcgcaagaacgttccgatggtcgcgaacagaaaaggctctttg
ccacgagtctatggagatacgccttcgttcctgggggtcgatgtcgttgacatcaatcgc
cttgagaagggcagggacgtgatcttctccggggtgccctgggaaggaacggtgacctgg
gggtctttttcgggctgcgagctcgcgccgcgggcaatccggcacagcgcggcgcgatac
ggcggatttctgccggaatacgagctggatttctttgactatctgactgtcgcagatgcc
ggggatgtgtccgttgatccgaacagtccggaaaaaacgatgaacaacatctattcttcc
atggacaggatttacgggaagggaagcattccagtcacggtaggcggcgatcattccatt
accccgcccattgtggatgccctaggcaacaacgcgaagggccctatcggcattcttcat
ttcgacgctcatctggacaacgcgaaggttttcggtgaagatctgttcgcccgctgcagt
cccctgcatcgcatcgcccagaatgaaaaagtgagaacggaaagcatcgttcatatcggc
attcgggggccgagaaattctccctcccagttggagtatgcctggcagataggggcgaga
gtcttcaacatccgggagatcagagaaagaggcatgacttcggtcatcgacgaagcgctc
aggatcgcgtcaaaccagactgaacatgtgtatgtgacaatttgcagcgactgcattgac
gcgtccttcaatcccggaggcccagcggatttcaacggcctgtttcctcacgaattgttc
tcggctctctacacgatcggaagggcggggatatccggtttggactacgtggaagtctat
ccgattcaggacccgaattcgttttcttctcacctggcttcctgggcgatcatccatgcc
ctcgtggggctggcctcgggaaagaaaaaaaagagcgaaacggcaacggcctga

DBGET integrated database retrieval system