KEGG   Syntrophus aciditrophicus: SYN_01159Help
Entry
SYN_01159         CDS       T00346                                 

Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sat  Syntrophus aciditrophicus
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SYN_01159
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYN_01159
  Lipid metabolism
   00071 Fatty acid degradation
    SYN_01159
  Amino acid metabolism
   00350 Tyrosine metabolism
    SYN_01159
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SYN_01159
   00626 Naphthalene degradation
    SYN_01159
Enzymes [BR:sat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SYN_01159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(367860..368888)
Genome map
AA seq 342 aa AA seqDB search
MKAMILKGLSKYRESWTPLEPVELPIPEPGPGEIRIRVSACGICHTELDEIEGRTPPPRF
PVIPGHQVVGRVEKKGAGASEYQIGDRVGVGWIYSSCGQCRECRKGLENLCTDFRATGRD
VHGGYAQYMVVPAAFAHPVPERFTDTEAAPLLCAGAIGYRSLRLTGLEDGQNLGLTGFGA
SAHLVLKMVRRRYPHTDVYVFARSEKERDFARQLGAVWAGSTTDPSPRKLHAVIDTTPAW
KPIVEALKNLEKGGRLVINAIRKEEGDKSELLNLDYPDHLWLEKEIKSVANVARQDIREF
LELAAEIPLHPETQEYELREANRALAELKEGKVRGGKVLIMK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatgatcctgaaaggcctttctaaatacagggaatcctggacccctctggag
ccggtcgaactcccgatccccgaacccggcccgggagaaatccgcatccgtgtttccgca
tgcggaatctgccatacggaactggatgaaatcgagggtcggacgcctcccccacggttc
cccgtcatccctggacatcaggttgtcggcagggttgaaaaaaagggcgccggtgcatcg
gaataccagatcggcgaccgtgtcggcgtcggctggatttattcttcctgcggacaatgc
cgggaatgccggaaggggctggaaaatctctgtacagacttccgggcgaccggccgggat
gtccacggtggctacgctcagtacatggtcgttcccgcagcgttcgcccaccctgttccc
gaacgcttcacggataccgaggccgcgccgcttctctgcgcaggcgccatcggctaccgg
tcattacggctgacgggactggaagacggccagaatctggggttgacggggttcggggcc
tcggcacatcttgtcctgaaaatggtccggcgccgctatccccataccgacgtctatgta
ttcgctcgaagtgaaaaagaaagggattttgcccgtcaactgggcgccgtctgggcagga
agcacgacagatccgtcgccccggaagctccatgccgtcattgacacgacgcctgcctgg
aaacccatcgtcgaagccctgaagaacctcgaaaagggcggacggctggtcatcaatgcc
atccgcaaagaggaaggagacaaaagcgaactgctgaatctggattatcccgatcatctc
tggctggaaaaggaaatcaagagcgtggccaatgtcgcccgtcaggatatccgggaattt
ctggaactggccgcagagatcccccttcatccggaaactcaggaatatgaattgcgagag
gcgaatcgggcgctggccgaattgaaggaaggaaaagtcaggggcggcaaagttctgatt
atgaaataa

DBGET integrated database retrieval system