KEGG   Syntrophus aciditrophicus: SYN_01159Help
Entry
SYN_01159         CDS       T00346                                 

Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat00010  Glycolysis / Gluconeogenesis
sat00071  Fatty acid degradation
sat00350  Tyrosine metabolism
sat00625  Chloroalkane and chloroalkene degradation
sat00626  Naphthalene degradation
sat01100  Metabolic pathways
sat01110  Biosynthesis of secondary metabolites
sat01120  Microbial metabolism in diverse environments
sat01130  Biosynthesis of antibiotics
sat01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYN_01159
  Lipid metabolism
   00071 Fatty acid degradation
    SYN_01159
  Amino acid metabolism
   00350 Tyrosine metabolism
    SYN_01159
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SYN_01159
   00626 Naphthalene degradation
    SYN_01159
Enzymes [BR:sat01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SYN_01159
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 OCD_Mu_crystall NADH_4Fe-4S
Motif
Other DBs
NCBI-ProteinID: ABC76247
UniProt: Q2LPN4
Position
complement(367860..368888)
Genome map
AA seq 342 aa AA seqDB search
MKAMILKGLSKYRESWTPLEPVELPIPEPGPGEIRIRVSACGICHTELDEIEGRTPPPRF
PVIPGHQVVGRVEKKGAGASEYQIGDRVGVGWIYSSCGQCRECRKGLENLCTDFRATGRD
VHGGYAQYMVVPAAFAHPVPERFTDTEAAPLLCAGAIGYRSLRLTGLEDGQNLGLTGFGA
SAHLVLKMVRRRYPHTDVYVFARSEKERDFARQLGAVWAGSTTDPSPRKLHAVIDTTPAW
KPIVEALKNLEKGGRLVINAIRKEEGDKSELLNLDYPDHLWLEKEIKSVANVARQDIREF
LELAAEIPLHPETQEYELREANRALAELKEGKVRGGKVLIMK
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccatgatcctgaaaggcctttctaaatacagggaatcctggacccctctggag
ccggtcgaactcccgatccccgaacccggcccgggagaaatccgcatccgtgtttccgca
tgcggaatctgccatacggaactggatgaaatcgagggtcggacgcctcccccacggttc
cccgtcatccctggacatcaggttgtcggcagggttgaaaaaaagggcgccggtgcatcg
gaataccagatcggcgaccgtgtcggcgtcggctggatttattcttcctgcggacaatgc
cgggaatgccggaaggggctggaaaatctctgtacagacttccgggcgaccggccgggat
gtccacggtggctacgctcagtacatggtcgttcccgcagcgttcgcccaccctgttccc
gaacgcttcacggataccgaggccgcgccgcttctctgcgcaggcgccatcggctaccgg
tcattacggctgacgggactggaagacggccagaatctggggttgacggggttcggggcc
tcggcacatcttgtcctgaaaatggtccggcgccgctatccccataccgacgtctatgta
ttcgctcgaagtgaaaaagaaagggattttgcccgtcaactgggcgccgtctgggcagga
agcacgacagatccgtcgccccggaagctccatgccgtcattgacacgacgcctgcctgg
aaacccatcgtcgaagccctgaagaacctcgaaaagggcggacggctggtcatcaatgcc
atccgcaaagaggaaggagacaaaagcgaactgctgaatctggattatcccgatcatctc
tggctggaaaaggaaatcaagagcgtggccaatgtcgcccgtcaggatatccgggaattt
ctggaactggccgcagagatcccccttcatccggaaactcaggaatatgaattgcgagag
gcgaatcgggcgctggccgaattgaaggaaggaaaagtcaggggcggcaaagttctgatt
atgaaataa

DBGET integrated database retrieval system