KEGG   Syntrophus aciditrophicus: SYN_01350Help
Entry
SYN_01350         CDS       T00346                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
sat  Syntrophus aciditrophicus
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYN_01350
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SYN_01350
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    SYN_01350
Enzymes [BR:sat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SYN_01350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(711297..712454)
Genome map
AA seq 385 aa AA seqDB search
MNENREQVLKNVKRVLIKIGSAVLTGDNGLDLERIQHLVDQMAALTHRGYQVVMVTSGAI
ASGKHRLGITTALKSIPQKQAAAAIGQGRLMRIYSNSFGKHGLYVGQILLTMSDLTDRRR
FLNIRNTLSTLMEWGIIAIINENDTVAIDEIKFGDNDNLAAMIANIIEAHLVINLTSTPG
LYDRNPASSRNARLIPLVREITEDIEAAASEEGTSVGTGGMKSKVMAAKKVTAFGIPYII
APGKQKDVLLDIFDGNELGTLFLPMREHLSSRKYWIAFTLRSRGVLSIDAGARTAILEEG
KSLLPSGIVGVEGDFIVGDPVTCVDRDGVPLAKGLVNYSAPDIRKIMGLKTSRIEQVLGH
KDYDEIIHRDNLAVIRRSRRHREAG
NT seq 1158 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaaatcgagaacaagtcctgaaaaatgtaaagagagttctgataaagatcggc
agcgccgtccttacaggcgacaacggcctcgacctggaaaggatccagcacctggtggac
cagatggccgccctgacacacaggggctatcaagtcgtcatggtcacctcgggcgccatc
gcctcggggaaacaccgcctcggcattaccaccgctttgaagagcattccccagaagcag
gccgcggcagccatagggcagggacgcctgatgcgcatttattccaattccttcgggaaa
cacggcctctatgtcggacagattcttctcaccatgagcgatctgacggatcgaaggcgt
ttcctcaatatccgcaataccctttccaccctcatggaatggggcatcatcgccattatc
aacgaaaacgacaccgtggccatcgatgagatcaaattcggcgataacgacaatctggcc
gccatgatcgccaatatcatcgaagcccatctggtcatcaatttaaccagcacaccggga
ctctatgatcggaatcccgcttcatccaggaatgccagactgattccccttgtccgggaa
atcacggaagatattgaagcagccgcgtcggaggaagggacctccgtcggaacgggaggg
atgaaaagcaaggtcatggcggccaaaaaggtaaccgccttcggcatcccttacattatt
gctcccggaaagcagaaggacgttctgctggatatctttgatggaaacgagctgggcacc
cttttcctccccatgagagagcatctcagcagccgcaaatactggattgcctttaccctc
agatctcgaggggttctgagcattgacgccggcgcccgaaccgcgattctggaagaggga
aaaagcctgctgccctcaggaattgtcggtgtggaaggtgatttcatcgtgggagacccg
gtcacgtgcgtcgatcgggacggcgttcccctggccaaggggctggttaattacagcgct
cccgatatccggaagatcatgggactcaagacgtcccggatcgaacaggtgctgggacac
aaggactatgacgaaatcattcaccgcgacaacctggccgtgatccgtcgcagtcgcaga
cacagagaagcaggctga

DBGET integrated database retrieval system