KEGG   Syntrophus aciditrophicus: SYN_01532Help
Entry
SYN_01532         CDS       T00346                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
sat  Syntrophus aciditrophicus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SYN_01532
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SYN_01532
Enzymes [BR:sat01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     SYN_01532
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2267425..2268387
Genome map
AA seq 320 aa AA seqDB search
MHLPPGLCSRGFAMKWERKDILGMKDLSVEEIHMILDTAESFLEVSARDIKKVPTLRGKT
IINFFVEASTRTRTSFEIAGKRLSADTINISASASSLVKGETLADTARNLEAMNPDVIVI
RHSCAGAPHMLAGLVRQSIINAGDGAHEHPSQALLDMMTIRNRKGGLSGLNVTIVGDIAH
SRVARSNIYGLNKMGVCVTVAGPATMIPRDIQQLGVKVCFSLEEAILDADVIMMLRIQTE
REQQNIFPSLREYSTFYCLNRENIKKAKKDVLVMHPGPVNRGVEISPEIADGVHSVILEQ
VTNGVAVRMALLYLLTGASS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcatctgccgccaggtctctgttccaggggttttgcaatgaaatgggaacgtaaggac
attctgggcatgaaagatctttccgtagaggaaattcacatgatcctcgacacggcggag
tcgtttctcgaagtatccgcgcgggatatcaaaaaagtgccaacgctccggggaaagacg
atcatcaatttctttgttgaagccagtacgcggacccgaacctccttcgaaattgccggc
aagcggctgagcgccgacaccatcaatatctccgcatcagcaagcagcctggtcaagggg
gaaaccctggcggacacggcgagaaatctggaagccatgaatcccgacgtcatcgtgatc
cgtcacagttgcgccggagcgcctcatatgctggccggacttgtccggcagtccatcatc
aacgccggcgacggcgctcatgagcatccgagccaggctttgctggacatgatgacaatc
cgaaaccgcaagggggggctttccggattgaacgtgaccatcgtgggcgatatcgcccac
agccgcgtcgcccgttccaacatttacgggttgaacaagatgggagtctgcgtcaccgtg
gccggccccgccacgatgattccccgggatatccagcagcttggcgtcaaggtctgcttc
agtctggaagaggccattcttgatgcggatgtcatcatgatgctcaggattcagacggag
cgcgaacagcagaacatcttcccttcccttcgggaatattccactttttattgcctgaac
agggagaatatcaaaaaagcgaaaaaggatgtcctggtgatgcatcccggtccggtcaac
cgcggcgtggaaatttctccggagatcgccgacggcgttcattccgtcattctggaacaa
gtcaccaacggggtcgcggtccggatggcccttctttatctgctgacaggagcctcttca
tga

DBGET integrated database retrieval system