KEGG   Syntrophus aciditrophicus: SYN_01824Help
Entry
SYN_01824         CDS       T00346                                 

Definition
type III restriction-modification system restriction subunit (EC:3.1.21.5)
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
sat  Syntrophus aciditrophicus
Brite
Enzymes [BR:sat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     SYN_01824
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1694070..1697147)
Genome map
AA seq 1025 aa AA seqDB search
MKLKFKVQPYQTNAVEAVVDCFAGQVNTSGIVYRIDPGVNKKLVAQEPILPGMDMEQTGF
KNADIQLTDAQLLTNIHAVQRRQNLPLSDKLVSSAGCKINLDVEMETGTGKTYCYVKTFF
EMNKRYGWTKFIVVVPSIAIREGVLKSLEITAEHFTESYGKKARFFAYNSRQLHHLESFS
SDAGINVMVINIQAFNATGKDNRRIYDELDEFQSRKPIDVISSNRPILILDEPQKMEGKK
TLEALAKFKPLMILRYSATHRTTHNKIHRLDALDAYNQKLVKKIAVRGIAVKGLAGTNAY
LYLESIEISKKAPVARIEMEVRQGGGIKRIVKRLERGKDLFIESNELDQYRGFVIAQIDA
NKDTVEFTNGHVLSAGDATGDITEMAIRRIQIREAIRAHLEKEQVLFAQGIKVLSLFFID
EVVKYRDYSQADEQGEYARIFEEEYERLKAEYLSLLPLDGGVYQEYLKGIHVGRTHNGYF
SIDKKTKKLTDPSFKTRGEEAGLSDDVDAYDLILKDKERLLSFAEPVRFIFSHSALREGW
DNPNVFVMCMLKHSDNTISRRQEVGRGLRISVNQLGDRMDNPATVHDVNILTVVASESYK
DFVGNLQREISDSLSARPRKADEAYFTGKVITTETGTVEITPVMAKQIYKYLLKNDYTDD
ADQVADAYHEAKANGTLAALPPELAPHAEQIFGLIDSVFSESQLPDVGDDRKPKTNPLNA
NFEKKEFKALWSRINQKAVYRVEFDSSELIRNSIRALDKELRVTPLTYIVQKGVQTTEAT
YDRLKSGQAFDVKETKTEYGTSVHSRVTYDLLGKISENTQLTRKTIAEILSGVQTAVFMQ
FKQNPEHFIAESSRLINEQKATIIIERLSYDNIAETHDIDIFTTGQSKQDFTKASEKLKN
HIYDYVITDSKVEREFVKELDTSTEVVVYAKLPRGFLIPTPVGDYNPDWAISFREGSVKH
IYFVAETKGSMSSMELRAIEHTKIECARKFFAEINRKIDPEHVKYDVVTSYGKLMEIVGM
GGARV
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaagttcaaagtccagccctatcagaccaacgcggtggaagctgtggttgac
tgctttgccgggcaggtgaatacctcgggcattgtgtaccggatcgacccgggcgttaac
aaaaagctggtggctcaggaaccgattttgccaggaatggatatggagcagactggattc
aagaacgccgatatccagcttacagatgcccagctgctgaccaatatccatgccgtacag
cggcggcagaatttgcccttgtccgacaaactggtttccagcgccgggtgcaagatcaac
cttgacgtggagatggaaaccggaaccggcaagacctattgctacgtcaaaaccttcttc
gagatgaacaagcggtacggctggaccaagttcatcgtggtggtgcccagcattgccatc
cgtgaaggcgtgcttaagtcgctggaaattaccgccgagcatttcaccgagagctacggc
aagaaggcccgtttttttgcctacaactccaggcagctgcaccatctggaaagcttttcc
tccgatgcgggcatcaatgtcatggtcatcaatatccaggcgttcaatgccacgggaaag
gataaccgccgcatctatgacgaactggacgaattccagtcgcgcaagcctatcgatgtg
atcagcagcaaccgccccatcctgattctggatgaaccacagaagatggagggcaaaaag
acgctggaggcgctggccaagttcaagccgctgatgatcctgcgctactcggctacccac
cggaccacgcacaacaagatccaccgcctcgacgccctggacgcctacaaccagaagctg
gtgaagaagatcgcggtgcgtggcattgcggtgaagggtctcgctggtaccaacgcctat
ctctacctggaatccatcgagatttccaagaaggcaccggttgcccgaatcgaaatggaa
gtgcgccagggaggcggaatcaagcggatcgtcaaacgcctggagcgaggcaaggatctg
ttcattgagtcaaacgagctggaccaatatcgcggcttcgtcatcgcccagatcgacgcc
aacaaggacacggtggagttcaccaacggccatgttctgagtgcgggtgatgcaaccggc
gacatcacggaaatggctatccggcggattcagatccgggaggcgatcagggctcacctt
gagaaggagcaggttctttttgcccagggcatcaaggtgctgtctcttttcttcatcgac
gaggtggtcaaataccgggactatagccaggccgatgaacagggagagtacgccaggatt
tttgaagaagagtacgagcggctcaaagccgaatatttaagccttcttcccttggatggt
ggagtgtatcaggaatatctgaagggcattcatgttggccgcacccacaacggttacttc
tccatcgacaagaaaaccaagaagctcaccgatccgagcttcaagacgcgtggagaggaa
gccgggctttccgatgacgtggatgcatatgatctgatcctgaaagacaaggaacggctg
ctctccttcgcggaaccggtccgattcattttctcccactctgccctgcgggaaggctgg
gacaaccccaatgtcttcgtcatgtgcatgctcaagcacagcgacaacacgatctcgcgc
cgccaggaagttggccgggggttgcggatcagtgtcaaccagctcggggatcgcatggac
aacccggcaacggtccatgacgtgaatatcctgaccgttgtcgcgagcgagagctacaag
gacttcgttgggaatcttcagcgtgaaatcagcgactccctctctgcacgcccccgcaag
gcggacgaggcctacttcaccgggaaggtcataaccacggaaaccggtacggtggaaatt
accccggtcatggccaagcagatatacaaatatctgctcaagaacgactataccgatgat
gcggatcaggttgccgacgcctatcacgaggcaaaagccaacgggactctggcggcgctt
ccgcccgagcttgcccctcatgcggaacagattttcggcctgatcgacagcgtcttcagt
gagtcccagctgcccgacgtgggtgatgaccgcaagccgaagaccaatccgctgaatgcc
aacttcgagaagaaagagttcaaggcactctggagccgaatcaatcagaaggcggtctac
cgtgtcgagttcgattccagtgaactcattcgaaacagcatccgggctctggacaaagag
ctgcgggtgactccacttacgtacatcgtccaaaaaggtgtgcaaaccacggaagctacc
tacgaccgattgaagtctggtcaagccttcgatgttaaagaaacgaagacagaatacggc
acttcagtgcattccagggtaacctatgacctgctcgggaaaatctccgaaaacacccaa
ctgacaagaaagaccatcgccgaaatattgagcggtgttcaaacggcggttttcatgcaa
ttcaagcagaacccggagcatttcattgccgaaagctcacggcttatcaatgagcagaag
gccacgatcatcatcgagcggctaagctacgacaacatcgccgagacccacgatatcgat
attttcacgacaggccaaagcaagcaggacttcaccaaagccagtgagaagctgaagaac
cacatctatgactacgtgattaccgactccaaggttgagcgggagtttgtgaaagagctg
gataccagcaccgaggtggtcgtctatgcaaagctccccagaggcttcctgatccccact
cccgtcggcgactacaacccggactgggccatttccttcagggaaggctcggtcaagcac
atctatttcgtcgccgagaccaagggctccatgtccagcatggaacttcgggcaatcgag
catacgaaaatcgaatgcgcccgcaagttcttcgcggagatcaaccgcaagattgatccc
gaacacgtgaaatacgacgtggtgaccagctacggaaagctgatggagattgtcggtatg
gggggagcaagagtatga

  All links  
No link information was found.   
DBGET integrated database retrieval system