KEGG   Syntrophus aciditrophicus: SYN_01942Help
Entry
SYN_01942         CDS       T00346                                 

Definition
(GenBank) trytophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sat  Syntrophus aciditrophicus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYN_01942
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYN_01942
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SYN_01942
Enzymes [BR:sat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SYN_01942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1895646..1896839)
Genome map
AA seq 397 aa AA seqDB search
MKGLLPDKRGHFGIFGGRYAAETLMPALIELEKAYRQARRDKVFREEYSRYLQDYSGRAT
PLYFAQRLTEALGGAKIYLKREDLNHTGSHKINNTLGQALMARRLGKKKVIAETGAGQHG
VATATVAALFGMECRIFMGEEDIRRQAPNVFRMKILGSEVIPVSSGTATLKDAMNEAMRY
WVSAVQDTFYVIGTTAGPHPYPMMVRDFQSVIGREVKRQILRKEGRYPDILIACVGGGSN
AMGLFYPFRGEENVAMFGVEAAGKGLDSPLHSASISAGRVGVLHGNRTFLLQDEHGQIRD
AYSIAAGLDYPGVGPEHSYFSHIGRASYVAVTDEEAVEAFKTLSRYEGIIPAMESAHALA
YAMKLVPTLKREQLVVVNLSGRGDKDAEVIARQMEVQ
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaagggttattaccggataaacgcgggcacttcggaattttcggcggacgctatgcc
gctgagacgctgatgcctgctctgattgaactggaaaaagcctatcgtcaggctcggcgg
gacaaggttttccgggaagaatattcccgctatcttcaggattattcaggaagggctacg
ccgctttattttgctcagaggctgacggaagctttgggcggagcgaaaatctatctgaag
cgggaagatctgaatcacaccggttcacacaagatcaacaacaccctggggcaggcgctg
atggccagacggctgggaaaaaagaaggtcatcgcggaaacgggggcgggtcagcacggc
gtggcaacggctacggtggctgcgctgttcggcatggaatgccgcattttcatgggggaa
gaagacatccggaggcaggctccaaatgtcttccgcatgaagatcctcggctcggaggtg
attcctgtctcttccgggacggccacactcaaggatgccatgaatgaggcgatgagatac
tgggtttccgccgttcaggataccttttatgtcattggaactacagccgggccccatccc
tatcccatgatggtcagggattttcagagcgtgatcggtcgggaggtcaaacgacagatc
ctcaggaaggaagggagatatccggatatcctgatcgcctgtgtcggcggtggaagcaat
gccatggggctcttctatcccttccgcggggaagaaaatgtggcgatgttcggcgtcgag
gcggccggcaaagggctggattctccgctccactccgccagcatcagcgccggacgcgtg
ggagtgctccatggcaatcgcacctttctgcttcaggatgagcatggccagatccgggat
gcttattccatcgccgcaggactggattatcccggtgtcggtccggagcacagttatttt
tcccatatcggccgggcttcctatgtcgcggtaacggatgaggaggcagtcgaggccttc
aagacgctttcccggtatgaagggatcattcccgccatggagagcgctcatgccctggct
tatgccatgaagctggttccgacgctgaaacgggagcagcttgtcgtggtcaatctttcc
ggaaggggagacaaggatgcggaagtgatcgccagacagatggaggtacaatga

DBGET integrated database retrieval system