KEGG   Syntrophus aciditrophicus: SYN_02122Help
Entry
SYN_02122         CDS       T00346                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sat  Syntrophus aciditrophicus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYN_02122
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SYN_02122
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SYN_02122
Enzymes [BR:sat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SYN_02122
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1088775..1090226
Genome map
AA seq 483 aa AA seqDB search
MKVEFSVPRRREKLHRMGEFMRERILYYSTNCYLDNVEGMEPFKDRVSFREALLLGQAPD
EGLFMPESIPQLSLDEILNLKGRPYTAAALLVAEAYLGADLPLETLKAVIESSYNYEVPL
ERVVDRRYVLRLDRGPTASFKDFAARMMARLMSHFRDPGKRLNVLVATSGDTGSAVGEAF
KGVAGIDVYILYPREEVSGRQKKQLDTIGGNVRTLSVEGKFDDCQDLVKQAFADPALAGL
NLTSANSINFGRILPQMIYYVYAYAQLAERGEEIVFSVPSGNFGDALGCEYARRMGLPVA
QLVMPTNENDEFPRFLKTGRYEKISPSLACLSNAMNVGHPSNLARFFDLYGGTVDRTGRV
HKMPDLEEMRNNIFSVSVSDEETRRTIRRAYDSYGLILEPHGAVGWRGLELYLEQTGRKV
LCVSLETAHPAKFPEEIVSLLGISPELPASMRDIDSRTGEPLPMTGDYNVFRKFLEKTLK
AMD
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggtggaattcagcgttccacgccgtcgggaaaagttgcaccgtatgggggaattc
atgagagagagaatcctgtattacagcacgaattgttacctcgataatgttgaaggaatg
gagccgttcaaggatcgagtttccttccgggaagccctgcttctggggcaggctccggat
gaaggactgttcatgcccgagagcattccccaactgtccctcgacgagatcctgaatctg
aaaggcaggccctatacggcggccgctctgctggtggcggaggcttatctcggggcggat
ctgcctctggaaactctgaaggcggtgattgaatcttcctataattatgaagttcccctg
gaacgcgttgtggaccgtcggtatgttctccgactcgaccggggaccgacggcttccttc
aaggatttcgcggcccggatgatggcccgcctgatgagtcattttcgcgatccgggaaag
cgcctcaatgtcctggtggccacttcgggggatacaggcagtgccgtgggggaagccttt
aagggcgttgccggaattgacgtctatatcctgtatccccgggaagaggtgagtggccgg
cagaaaaagcagttggacaccatcggcggcaatgtccggaccctgtccgtggaaggaaag
ttcgatgactgccaggatctcgtcaaacaggcctttgccgatcccgccctggcgggattg
aatctgacctccgccaattccatcaatttcggccggattctaccccagatgatttattat
gtttatgcctatgcccagcttgccgaaaggggggaagagatcgtcttttccgtgccgtct
ggaaacttcggagacgccctgggatgtgaatacgcacggcgcatgggcctgcccgtcgcc
caactggtgatgcccaccaacgagaacgacgagtttccccgttttctgaaaaccggccgt
tacgaaaagatatcgccttctcttgcctgtctgtcgaatgccatgaacgtcggccatccg
agcaatctggcccggttttttgacttatacggggggacagtggaccggacaggtcgtgtg
cacaagatgccggatctggaagagatgaggaacaatatcttctccgtttctgtctccgat
gaggaaacccggcggacgatccgaagggcttacgattcgtacggactgattctggaacca
catggagctgtgggctggcggggtcttgaactctatctggaacagaccgggaggaaagtg
ctctgtgtatccctggaaacggctcatccggcaaaattccccgaagaaatcgtttcgctg
ctgggcatcagtcccgagttgccggcaagcatgcgggatatcgactcgcgaaccggcgaa
cccctgccgatgacaggcgattacaatgtatttcgtaaatttttggaaaaaacgttaaag
gccatggattga

DBGET integrated database retrieval system