KEGG   Syntrophus aciditrophicus: SYN_02163Help
Entry
SYN_02163         CDS       T00346                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
sat  Syntrophus aciditrophicus
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:sat00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1467572..1468102
Genome map
AA seq 176 aa AA seqDB search
MDKAGNPLCEEVLGVIAYIGIGSNLGQPLEQCLEAIKCLSSVNAITLLRCSSLYRTEPIG
LKNQPWFVNAVAEIRTSLSPRALLRILMQIEEAMGRVREAHWGPRIIDLDILLFGQEIVQ
EQDLKIPHPELHKRRFVLIPLSELASYAIHPAFGVSIRGLMERLEDDSRVERIEYG
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
gtggataaagcagggaatcctttgtgtgaagaagttttgggggtcattgcctatatcggc
atcggatcgaatcttgggcagcccttggaacagtgtctcgaagccattaagtgtctttcg
tctgtcaacgccattacgctcctgcgttgttcctctctttacaggactgaaccgataggg
ttgaaaaatcagccctggtttgttaatgccgttgctgaaatacgtacatctctttcaccg
cgagcgcttttgcgaatcctcatgcagattgaggaagctatggggagagttcgggaagcg
cattggggtccacggatcattgatctggatattctcctgttcgggcaggagatcgttcag
gagcaggatctgaagattcctcatcccgaactgcataaaaggcgttttgtccttatcccg
ctgagcgaactggcctcctatgcgattcatccggctttcggggtatcgattcgtggactc
atggagaggcttgaggacgacagccgggttgaacgcattgaatatggttaa

DBGET integrated database retrieval system