KEGG   Syntrophus aciditrophicus: SYN_02232Help
Entry
SYN_02232         CDS       T00346                                 

Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
sat  Syntrophus aciditrophicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SYN_02232
   01230 Biosynthesis of amino acids
    SYN_02232
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYN_02232
   00030 Pentose phosphate pathway
    SYN_02232
   00051 Fructose and mannose metabolism
    SYN_02232
  Energy metabolism
   00680 Methane metabolism
    SYN_02232
Enzymes [BR:sat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     SYN_02232
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     SYN_02232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
614574..615674
Genome map
AA seq 366 aa AA seqDB search
MKTTLSIIKADVGSVGGHIRPSERLIQEVKNFVVEKGQGVISDFFISHTGDDIAILLSHS
RGKGDGIIHQLAWDAFVTGTKVAKEQGLYGAGQDLLKDSFSGNVRGMGPAVAEMEFEERP
NEPFLFFAADKTDPGAYNLPLYLAFTDPMYNSGLILSPTMNKGFRFVIMDVEYTEGDRVI
ELNAPEDIYDIAALLRDNERFVVEAIYSRSTGDIAVSVSTTRLHNIAGKYTGKDDPVMLV
RVQGTFPATGEVLAPFNIGHFVAGFMRGSHTGPLMPVKMNSGISYFDGPPIICCLAFCVH
KGKFTEPADAFDHPYWDYIRNNVARKATEMRAQGFSGAAMLPYSELEYGGIVEKMKILDE
RFKVRG
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgacactgagtattattaaggctgatgtgggaagcgtcggagggcatatccgg
cctagtgaacggctgatccaggaagtgaaaaattttgtggtggagaagggtcagggagtc
atttccgattttttcatcagccatacaggtgacgacatcgcgattcttctctcccattcc
cgcggcaagggcgatgggatcatacaccagctggcttgggacgcctttgtgaccgggacc
aaggtggccaaagagcagggtctctatggcgccgggcaggatttgctgaaggattccttc
tccggtaacgtgaggggaatggggcctgcggtggcggagatggaattcgaagagcgaccg
aatgagcccttcctctttttcgccgccgataaaactgatcccggagcgtataacctgcct
ctttaccttgcctttacggaccccatgtacaattccggattgattctcagccctacgatg
aacaaagggttccgctttgtcatcatggatgtggaatacacggagggagacagggttatt
gaattgaacgccccagaggatatctacgatatcgctgcactattgagagacaacgagcgt
ttcgtcgtcgaggcgatctattcccgcagtaccggagacatcgctgtttccgtaagcacc
accaggcttcacaatattgcaggcaagtacacggggaaagacgatcctgtgatgctggtc
agagtccagggaaccttcccggccaccggcgaggtcttggcccccttcaacatcggccat
ttcgtggctggtttcatgagaggaagccacactgggccgttgatgccggtaaaaatgaat
tccggcatctcctatttcgatgggccgccgattatctgctgtcttgctttttgcgtccac
aagggaaaatttacggaacccgccgatgccttcgaccatccctactgggactacatccgg
aacaatgttgcgagaaaggcgaccgaaatgcgggctcagggtttctcaggagcggcgatg
cttccctacagtgaattggagtatggtggaattgtcgagaaaatgaagatccttgatgaa
cgatttaaagtgcggggttaa

DBGET integrated database retrieval system