KEGG   Syntrophus aciditrophicus: SYN_02267Help
Entry
SYN_02267         CDS       T00346                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat00860  Porphyrin and chlorophyll metabolism
sat01100  Metabolic pathways
sat01110  Biosynthesis of secondary metabolites
sat01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SYN_02267
Enzymes [BR:sat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     SYN_02267
Exosome [BR:sat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SYN_02267
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD ALS2CR8
Motif
Other DBs
NCBI-ProteinID: ABC76458
UniProt: Q2LQU6
Position
575279..576253
Genome map
AA seq 324 aa AA seqDB search
MNFPEYRPRRLRKNDLFRRLIRETRLSVDSFIFPLFATVGKGVKKPIDSMPGHFQLSVEL
LVKEVQECRELGIPAVLLFGIPERKDEAASGAFARDGIVQQAVRRIKDKVPDILVVTDVC
LCEYTDHGHCGMIEKGEVHNDMTLEVLAETAVSHAKAGADMVAPSAMMDGQVGAIREGLD
EAGFETVPILAYSAKYASCFYGPFREAAESASRFGDRKAYQMDPANSDEAVREMNLDVQE
GADILMVKPALPYLDVIRRAKEEFDLPVAAYNVSGEFAMIKAAARLGWIDEEKAMMESLT
AIRRAGADIILTYFAREAAKVLQR
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccccgagtatcgaccccggcgactccggaagaacgatcttttccggcggctc
atccgggaaacccgtctgtctgtggattccttcatttttcccctgtttgcaacggtcggc
aagggagtgaaaaaacccatcgattccatgccgggtcatttccagctatccgttgagctg
cttgtaaaagaggttcaggaatgtcgggaactgggaatcccggcagtgttgcttttcggg
attccggagaggaaggacgaagcggcttccggggcctttgcccgggatggaattgtgcag
caggctgtccggcggatcaaggacaaggttccggatattctcgtggtgacggatgtctgc
ctctgcgaatacacagaccacggccactgcgggatgattgaaaagggagaggttcacaac
gacatgaccctggaggtgctggcggaaacggccgtctctcatgcgaaggcgggggcggat
atggtggccccctcggccatgatggacggtcaggtcggggcgatccgcgaagggctggat
gaggcgggatttgaaacggttcccattctggcctattcggcgaagtatgcctcctgcttt
tacggccccttccgggaggcggcggaaagcgcctcccgctttggcgaccggaaggcctat
cagatggatccggccaacagtgatgaagccgtccgggagatgaacctggatgttcaggaa
ggcgccgacatcctcatggtgaagccggccctgccttatctcgatgtcattcgtcgcgcg
aaggaagaattcgatctgcccgttgcggcctataatgtcagcggcgaattcgccatgatc
aaggccgctgcccgactgggctggattgatgaagaaaaagccatgatggaatctttgacg
gccatccgccgtgccggtgcggacatcattctgacctatttcgctcgggaagcggcgaaa
gttctccagcgatga

DBGET integrated database retrieval system