KEGG   Syntrophus aciditrophicus: SYN_02551Help
Entry
SYN_02551         CDS       T00346                                 

Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:sat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SYN_02551
Enzymes [BR:sat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SYN_02551
DNA repair and recombination proteins [BR:sat03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     SYN_02551
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 Helicase_RecD AAA_11 UvrD_C PhoH AAA_22 DUF2075 T2SSE AAA_28 AAA_16 UvrD-helicase AAA_24 Mg_chelatase AAA_5 AAA_33 ATPase AAA NTPase_1 Zeta_toxin
Motif
Other DBs
NCBI-ProteinID: ABC77338
UniProt: Q2LTC7
Position
1492827..1494839
Genome map
AA seq 670 aa AA seqDB search
MTDLLKRILRKGEMPMLPDEALLFYFSDLDRHFGRLMEKISGGDNQDVFLAAALTSRSNR
GGHVCLDLAEYAGRPLMADIREEPEDEILEEMPESILLSCPPLSIWRETLLACSVVGTPG
EYKPLILDDKSRLYLYRYWSYEDTLVRFIKSCGNPAESEDFRKISNVSLDLSGLGHNLQT
FFPEDAGQFRFEDDKSKIFPDWQKIAALAVLRNRLVVISGSPGTGKTTTAARALALLQIL
SRGPKLRIALAAPTGKAAVRLDEAMNSAYARVGLNDQQGKAMTVHRLLGTVAGSPYFRHG
PGNPLPYDVIVVDEASMVDLPLMAKLVQALSPASRLILLGDRDQLASVEAGAVLGDLCGP
DDAGNFFSQAFRQEIRRMTGESCLPPVPFRHLPPVPFRHLPPVSDSMVQLQKNYRFDENS
GIGQLSRAVNRGDKDRVFSILNSSRCSDIAWENLPDPLGLPRLIEENLIHYFRKYMQMVI
NNDNPEVIFDYFERFRILCALRRGPFGVVYVNALLESMLRSERLIAGSGRWYPGRPIMIN
RNDYSLGLFNGDVGLTLPEHGGSGLSVFFRDSEGNFRRFAPFRLPEHETVYAMTVHKSQG
SEFDEVLMILSDRDSPLLTRELIYTGVSRAKKGLLLWGREDIIRQAISRRIKRTSGLRDA
LWESADVSDS
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgacggacttattgaaaagaatcctgcggaaaggagaaatgccgatgttgcctgatgag
gccctccttttttacttctccgacctggatcgtcatttcggacgactgatggaaaagatt
tccgggggggacaaccaggatgtctttctggctgccgcactgaccagccgaagcaaccgg
ggtgggcatgtctgcctcgatcttgccgaatatgcaggcaggccactcatggcggatatc
cgggaggaaccggaagacgagatactcgaggagatgcccgaaagcatcctgctgtcctgt
ccacccctttccatctggagggaaaccctgctggcatgctccgttgtcggaacgccaggt
gaatacaagcccctgatcctggatgataagtcgcggctttatctttaccgttactggtct
tatgaagacactctggtccgttttatcaaatcatgcggaaatccagctgaatcggaggat
ttccggaaaatatcaaatgtatctctcgatctttccggtcttggacataacttgcagact
tttttcccggaggatgcagggcagttcaggtttgaggatgacaagtcgaaaatttttccg
gactggcagaagatcgccgctctcgccgtcctgcgaaaccgtctggtcgtcatttctgga
agccctggaacgggaaagacaacgacggcggcacgggctcttgctctgctgcagatattg
agccgcgggccgaagctgcgtattgccctggccgcacctaccggaaaggcggctgtccgc
ctggacgaagccatgaattcggcttatgcccgagtcggactcaatgatcaacagggtaag
gcgatgacggtgcaccggttgctggggactgtagccggctctccctattttcgtcacggg
ccgggaaatcctctgccatacgatgtgattgtcgtggatgaggcctccatggtcgatctc
cccctgatggccaaactggttcaggctctctccccggcttcccggctgatactactgggg
gatcgggatcaattggcctctgttgaggctggcgccgtgctcggtgatctctgcggcccc
gacgatgcaggaaatttcttttcacaggcatttcggcaggaaatcagaaggatgaccggc
gagtcgtgtttgccgccggttcctttccggcatttgccgccggttcctttccggcatttg
ccgcccgtcagtgacagtatggttcagttgcagaaaaactatcgtttcgacgaaaacagc
ggcatcggtcagctcagcagggcggtcaaccggggggataaagaccgagtcttcagcatt
ttgaattcgtcacgctgttccgacatagcctgggagaatctgcccgacccgctgggactg
ccccggttaatcgaggaaaacttaattcattacttcaggaaatacatgcaaatggttata
aataatgacaatcctgaagttatatttgattattttgagcgattcaggattctctgcgcc
cttcgtcgaggaccattcggcgtggtgtacgtcaatgccctgctggaaagtatgctgcgg
tcggagcgcctgatcgccgggagcggaaggtggtatccgggacggcccataatgattaac
cgcaacgactattctctggggctcttcaatggggacgtgggcttgacccttcctgaacac
ggcggcagcggactttccgttttcttcagagactccgaagggaatttccgccgtttcgct
ccatttcggcttccggaacatgaaaccgtatacgccatgaccgtgcacaagagtcaggga
tcagagtttgacgaggttctgatgattctgtccgatcgggattcgccgttgttgactcgg
gaactgatttacacaggcgtatcgcgggcgaagaaaggtcttcttctgtggggaagagaa
gatatcatacgccaggccatttcgcgccgcattaaacggacatccggacttcgtgacgcg
ttgtgggaaagcgcggatgtctcagactcctga

DBGET integrated database retrieval system