KEGG   Syntrophus aciditrophicus: SYN_02551Help
Entry
SYN_02551         CDS       T00346                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sat  Syntrophus aciditrophicus
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sat03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1492827..1494839
Genome map
AA seq 670 aa AA seqDB search
MTDLLKRILRKGEMPMLPDEALLFYFSDLDRHFGRLMEKISGGDNQDVFLAAALTSRSNR
GGHVCLDLAEYAGRPLMADIREEPEDEILEEMPESILLSCPPLSIWRETLLACSVVGTPG
EYKPLILDDKSRLYLYRYWSYEDTLVRFIKSCGNPAESEDFRKISNVSLDLSGLGHNLQT
FFPEDAGQFRFEDDKSKIFPDWQKIAALAVLRNRLVVISGSPGTGKTTTAARALALLQIL
SRGPKLRIALAAPTGKAAVRLDEAMNSAYARVGLNDQQGKAMTVHRLLGTVAGSPYFRHG
PGNPLPYDVIVVDEASMVDLPLMAKLVQALSPASRLILLGDRDQLASVEAGAVLGDLCGP
DDAGNFFSQAFRQEIRRMTGESCLPPVPFRHLPPVPFRHLPPVSDSMVQLQKNYRFDENS
GIGQLSRAVNRGDKDRVFSILNSSRCSDIAWENLPDPLGLPRLIEENLIHYFRKYMQMVI
NNDNPEVIFDYFERFRILCALRRGPFGVVYVNALLESMLRSERLIAGSGRWYPGRPIMIN
RNDYSLGLFNGDVGLTLPEHGGSGLSVFFRDSEGNFRRFAPFRLPEHETVYAMTVHKSQG
SEFDEVLMILSDRDSPLLTRELIYTGVSRAKKGLLLWGREDIIRQAISRRIKRTSGLRDA
LWESADVSDS
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgacggacttattgaaaagaatcctgcggaaaggagaaatgccgatgttgcctgatgag
gccctccttttttacttctccgacctggatcgtcatttcggacgactgatggaaaagatt
tccgggggggacaaccaggatgtctttctggctgccgcactgaccagccgaagcaaccgg
ggtgggcatgtctgcctcgatcttgccgaatatgcaggcaggccactcatggcggatatc
cgggaggaaccggaagacgagatactcgaggagatgcccgaaagcatcctgctgtcctgt
ccacccctttccatctggagggaaaccctgctggcatgctccgttgtcggaacgccaggt
gaatacaagcccctgatcctggatgataagtcgcggctttatctttaccgttactggtct
tatgaagacactctggtccgttttatcaaatcatgcggaaatccagctgaatcggaggat
ttccggaaaatatcaaatgtatctctcgatctttccggtcttggacataacttgcagact
tttttcccggaggatgcagggcagttcaggtttgaggatgacaagtcgaaaatttttccg
gactggcagaagatcgccgctctcgccgtcctgcgaaaccgtctggtcgtcatttctgga
agccctggaacgggaaagacaacgacggcggcacgggctcttgctctgctgcagatattg
agccgcgggccgaagctgcgtattgccctggccgcacctaccggaaaggcggctgtccgc
ctggacgaagccatgaattcggcttatgcccgagtcggactcaatgatcaacagggtaag
gcgatgacggtgcaccggttgctggggactgtagccggctctccctattttcgtcacggg
ccgggaaatcctctgccatacgatgtgattgtcgtggatgaggcctccatggtcgatctc
cccctgatggccaaactggttcaggctctctccccggcttcccggctgatactactgggg
gatcgggatcaattggcctctgttgaggctggcgccgtgctcggtgatctctgcggcccc
gacgatgcaggaaatttcttttcacaggcatttcggcaggaaatcagaaggatgaccggc
gagtcgtgtttgccgccggttcctttccggcatttgccgccggttcctttccggcatttg
ccgcccgtcagtgacagtatggttcagttgcagaaaaactatcgtttcgacgaaaacagc
ggcatcggtcagctcagcagggcggtcaaccggggggataaagaccgagtcttcagcatt
ttgaattcgtcacgctgttccgacatagcctgggagaatctgcccgacccgctgggactg
ccccggttaatcgaggaaaacttaattcattacttcaggaaatacatgcaaatggttata
aataatgacaatcctgaagttatatttgattattttgagcgattcaggattctctgcgcc
cttcgtcgaggaccattcggcgtggtgtacgtcaatgccctgctggaaagtatgctgcgg
tcggagcgcctgatcgccgggagcggaaggtggtatccgggacggcccataatgattaac
cgcaacgactattctctggggctcttcaatggggacgtgggcttgacccttcctgaacac
ggcggcagcggactttccgttttcttcagagactccgaagggaatttccgccgtttcgct
ccatttcggcttccggaacatgaaaccgtatacgccatgaccgtgcacaagagtcaggga
tcagagtttgacgaggttctgatgattctgtccgatcgggattcgccgttgttgactcgg
gaactgatttacacaggcgtatcgcgggcgaagaaaggtcttcttctgtggggaagagaa
gatatcatacgccaggccatttcgcgccgcattaaacggacatccggacttcgtgacgcg
ttgtgggaaagcgcggatgtctcagactcctga

DBGET integrated database retrieval system