KEGG   Syntrophus aciditrophicus: SYN_02578Help
Entry
SYN_02578         CDS       T00346                                 

Definition
(GenBank) dihydropteroate synthase related enzyme
  KO
K18974  
dihydropteroate synthase type 1 [EC:2.5.1.15]
Organism
sat  Syntrophus aciditrophicus
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SYN_02578
Enzymes [BR:sat01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SYN_02578
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(220233..221159)
Genome map
AA seq 308 aa AA seqDB search
MGLCRYGAHNCCLFARPIPIVEVAAEADAMVTVFGILNLTEDSFFDESRRLDPAGAVTAA
IEMLRVGSDVVDVGPAASHPDARPVSPADEIRRIAPLLDALSDQMHRVSIDSFQPETQRY
ALKRGVGYLNDIQGFPDPALYPDIAEADCRLVVMHSAQRDGIATRTGHLRPEDALDEIVR
FFEARVSALRRSGVAADRLILDPGMGFFLSPAPETSLHVLSNLQKLKSALGLPLLVSVSR
KSFLGATVGLPVKDLGPASLAAELHAIGNGADYVRTHAPGDLRSAITFSETLAKFRSRDA
RDRGLDHA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggggctttgtaggtatggggctcataattgctgcctttttgctcgcccgatccccatc
gtggaagtcgctgcggaggccgacgccatggtgacggtgttcggcattctgaatctcacc
gaggactccttcttcgatgagagccggcggctagaccccgccggcgctgtcaccgcggcg
atcgaaatgctgcgagtcggatcagacgtcgtggatgtcggaccggccgccagccatccg
gacgcgaggcctgtatcgccggccgatgagatcagacgtattgcgccgctcttagacgcc
ctgtccgatcagatgcaccgtgtttcaatcgacagcttccaaccggaaacccagcgctat
gcgctcaagcgcggcgtgggctacctgaacgatatccaaggatttcctgaccctgcgctc
tatcccgatattgctgaggcggactgcaggctggtggttatgcactcagcgcagcgggat
ggcatcgccacccgcaccggtcaccttcgacccgaagacgcgctcgacgagattgtgcgg
ttcttcgaggcgcgggtttccgccttgcgacggagcggggtcgctgccgaccggctcatc
ctcgatccggggatgggatttttcttgagccccgcaccggaaacatcgctgcacgtgctg
tcgaaccttcaaaagctgaagtcggcgttggggcttccgctattggtctcggtgtcgcgg
aaatccttcttgggcgccaccgttggccttcctgtaaaggatctgggtccagcgagcctt
gcggcggaacttcacgcgatcggcaatggcgctgactacgtccgcacccacgcgcctgga
gatctgcgaagcgcaatcaccttctcggaaaccctcgcgaaatttcgcagtcgcgacgcc
agagaccgagggttagatcatgcctag

DBGET integrated database retrieval system