KEGG   Syntrophus aciditrophicus: SYN_02591Help
Entry
SYN_02591         CDS       T00346                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
sat  Syntrophus aciditrophicus
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sat01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sat00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
447364..448101
Genome map
AA seq 245 aa AA seqDB search
MLKKDASAGQGLRLSLSASIRKRQSEKYFPVISEVKVRSDKEGDLLRGRDPVALAQEMAR
CPVAGISVVTESEHFGGHMGLLSAVAAAVDIPVLHKDFIRNERQIEESADCGASAILIIT
ALLETKQMERLIEKAMCCGLETLVEAHSLAEIKKVEDLSFDLMGINNRDITVFELDDNDV
SRTEELAGFCKGSRILISESSISSAVEARRAGKGGADAVLVGTAVLKAASVRNFLDELTS
VGWPP
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaaaaagatgcttctgcgggacagggactaagactgtctctgtccgcatccatc
cggaaaagacaaagtgagaagtactttcccgtgatctccgaggtcaaggtgagatcggac
aaggaaggtgatctgctgcgtggccgtgaccccgtggcgctcgcgcaggaaatggcgcgg
tgtcctgttgcgggaatcagtgttgtcactgaatcggagcacttcggagggcacatgggc
ctgttgagtgcagtcgccgccgccgtggacattcccgtcctccacaaggatttcatcagg
aacgagcggcagatcgaagaatcggccgactgcggcgcttcggcgatcttaatcattacc
gccctgctggaaacgaagcagatggaacggctgattgaaaaggcaatgtgctgcggcctg
gagaccctggttgaggcgcatagtcttgcagagataaaaaaagtggaagacctttcgttt
gatctgatgggaatcaataaccgggacattaccgtcttcgagttggatgacaacgatgtg
agcaggacggaggagcttgccggcttctgtaaaggctcgcgtatcctgatcagtgaaagc
tcgatcagctctgcggtggaagcccggcgtgccgggaaaggcggcgccgatgccgtgctg
gttggtacggctgttttgaaagcggccagcgtgagaaattttctggatgaactgacgtct
gtcggatggccgccatga

DBGET integrated database retrieval system