KEGG   Syntrophus aciditrophicus: SYN_02650Help
Entry
SYN_02650         CDS       T00346                                 

Definition
(GenBank) CDP-4-dehydro-6-deoxy-D-glucose 3-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat00521  Streptomycin biosynthesis
sat00523  Polyketide sugar unit biosynthesis
sat01130  Biosynthesis of antibiotics
Module
sat_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    SYN_02650
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SYN_02650
Enzymes [BR:sat01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     SYN_02650
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom FdtA
Motif
Other DBs
NCBI-ProteinID: ABC78509
UniProt: Q2LWQ3
Position
complement(2654054..2654659)
Genome map
AA seq 201 aa AA seqDB search
MECRRGQVEDLVMKQNKRFDFHPTLIEGLWIVQRKPIEDSRGFFCRFFCAEEFQTAGLNR
PIAQINHTYTVNKGTVRGLHFQHPPHAEIKIVSCLQGEVYDVAVDIRKDSPTFLRWHGEI
LSVANQKSFFIPEGFAHGFQALTENCELLYLHSEAFHPQAEGGLHVEDPKIGIAWPIAVK
ELSQRDCAYPFINDDFKGLSL
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atggaatgccggcgaggccaggtggaagatctggtaatgaagcagaacaagcgatttgac
ttccatccgacgctgattgaagggctttggattgtacagcggaagcccatcgaggattcg
cggggctttttctgccgcttcttttgtgctgaagaatttcagaccgccggtttaaacagg
cccattgcacagatcaaccacacctataccgtaaataagggaactgtccgcggtctgcat
tttcagcatccgccgcatgcagaaatcaagatcgtcagttgtcttcagggtgaggtgtat
gatgttgctgtggatatcagaaaggattctcctaccttccttcgctggcacggagaaatt
ctgtctgtggccaatcaaaaaagtttttttatccccgaaggttttgcccacggttttcaa
gcgctgacagaaaactgcgagctgctttaccttcattccgaagctttccatccgcaggcg
gaaggcggacttcatgttgaggatccaaaaattggaattgcctggcccatagctgtgaag
gaactgtcgcaacgcgattgcgcttatcctttcataaacgacgattttaaggggctttct
ctatga

DBGET integrated database retrieval system