KEGG   Syntrophus aciditrophicus: SYN_02795Help
Entry
SYN_02795         CDS       T00346                                 

Definition
diaminopimelate aminotransferase (EC:3.5.1.18)
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sat  Syntrophus aciditrophicus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SYN_02795
  Amino acid metabolism
   00300 Lysine biosynthesis
    SYN_02795
Enzymes [BR:sat01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SYN_02795
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1595000..1596253)
Genome map
AA seq 417 aa AA seqDB search
MIDRDLFHKLSTRIDTYEKAMIEMQAAFTALPALSPDSGGQGEYEKAQYLLCQLREWGFP
DITEINAPDARVPSGCRPNILAGLPGRNPEMTVWILTHLDIVPPGELSFWDSDPYRVSVK
GRRVYGRGTEDNQQDMVSSLFAAKAFLDEGILPEASIGLAFVSDEETGSQFGLDFVLKNV
RNPFRMTDLIIVPDAGNDEGTMIEIAEKSILWLKFKTTGKQCHGSKPHLGRNAFLAASHL
IVELSKLYQLYSKSDLLYEPPVSTFEPTRKDANVPNINTIPGEDVFFMDCRVLPDYSLLD
ILLEIRRMADKIQDQFDVIIEITAVQENQAALPTSENAPVIRALQNAIKEVYSAEAFPGG
IGGGTVAAHFRKQGYPVAVWSRLGQMAHQPNEFCSIDTMLGNAKIYAHLFLQKQNSN
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atgattgacagagacttgttccacaaattgtccacgcggatcgatacatatgaaaaggct
atgatcgaaatgcaggcggcgtttacggcattgcctgctctttccccagacagcggagga
cagggcgaatatgaaaaagcgcaatacctattgtgtcaattgcgcgaatggggatttcca
gacatcacagagatcaacgcccccgatgccagggttccatcaggctgccggcccaatatc
ctggctggacttcccggccgcaatcctgaaatgacggtttggatcctgacccatctggat
atcgttccccccggagaactaagtttctgggacagcgatccatacagagtttctgttaag
ggcagacgggtatacgggaggggcaccgaagacaatcagcaggacatggtctcatccctg
tttgccgcaaaagcttttctcgatgaaggaatcctgcctgaggcatccatcggccttgcc
ttcgtttccgatgaagaaacgggcagtcaattcgggctcgattttgtattgaaaaatgtt
cggaaccctttccggatgacggacctgatcatcgttcccgacgcaggaaatgatgaggga
acaatgattgaaattgctgaaaaaagtatcctgtggctgaagtttaaaacaacagggaag
caatgtcacggcagcaaacctcacctcggcaggaatgcttttctcgcggcctctcattta
attgtggaacttagtaagctttatcaactatacagtaaaagcgatcttctctatgaaccg
cccgtcagcactttcgagccgacgcgaaaggacgccaatgtccccaatatcaataccatt
ccgggagaagacgtttttttcatggattgccgcgtcctccccgattactctcttttggat
atcctgctggaaataagaagaatggccgataaaattcaagatcagtttgacgttattatt
gaaataacggcagttcaggagaaccaggccgctcttcctacctcggaaaatgcacccgta
atcagggcattgcagaatgcaatcaaggaagtttactccgcggaggctttcccggggggt
ataggaggcggtactgttgccgcacatttccgaaagcagggttatccggttgctgtgtgg
tccaggctaggccaaatggcgcatcagcccaacgaattttgcagcattgacacgatgctc
ggcaatgcaaaaatctatgctcatcttttcttacaaaagcagaatagcaattaa

DBGET integrated database retrieval system