KEGG   Syntrophus aciditrophicus: SYN_02874Help
Entry
SYN_02874         CDS       T00346                                 

Definition
ribokinase (EC:2.7.1.15)
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
sat  Syntrophus aciditrophicus
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    SYN_02874
Enzymes [BR:sat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     SYN_02874
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2009294..2010238
Genome map
AA seq 314 aa AA seqDB search
MENRIFTSPPLICGIGQCSLDYLGRIPAYPPPDVKCEFSGLVIQGGGPVATALVALSRWG
MRCSFAGIIGDDAFGQAIETSLRNEGIDTSNLLVRRNSASQFAFITVEPDTGRRTIFWQR
PTGIPLQPWEIPQEQIRKSDVLHTDGLFIEASLQACRIARQAGVAVVVDAGTLREGMLEL
AGLSDYFIASETFARRLTGNSDPLDACSFLLKQGPKLVAVTLGAAGYVALHGNTTIRKSA
YPVNAVDTTGCGDVFHAGFIFGLVQGWNYETCLDFAAWAAAQVSLQLGGRKGIPPLSEIR
SRGYPCSRQEPAAR
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atggaaaacagaattttcacatcacctcctctgatctgcggtataggacagtgttccctg
gattacctcggtcggattcccgcctatccaccccccgatgtcaaatgtgaattttccggg
ttagtcattcagggaggcggacccgttgccaccgcgcttgtggccctttcccgctggggg
atgcgctgttcctttgccgggataatcggtgacgatgcttttggacaggccattgaaacc
tccctccgcaatgagggcatcgacacgtcaaacttgctggtccgacggaacagcgcctct
caatttgcctttatcaccgtcgagccggacaccggacggaggaccatcttctggcagcgc
cccacgggcatccctctccagccctgggaaatcccccaggaacagatccgcaaatccgac
gtgctgcatactgacggacttttcatcgaagcctcccttcaggcctgccgtattgcccga
caggctggagtggctgtggtcgtcgatgccggcacccttcgtgaaggaatgctggagctt
gccggtttgagcgattatttcatcgcctcggaaaccttcgcccgccggttgacgggaaat
tcggaccccttggacgcctgttcttttctgctcaagcagggtcccaaactcgtcgccgtt
acgctgggtgcggccggttatgttgctctccatggaaacacgacgatacggaaaagcgca
taccccgtaaacgccgttgacacaacgggctgcggagatgtctttcatgccggatttatc
ttcgggttggttcaggggtggaattacgaaacgtgtcttgattttgccgcctgggcggcg
gctcaggtgagtcttcagctggggggacgaaaaggaatccccccgctgagcgaaatcagg
agtcgaggctatccctgcagccgtcaggaacccgccgccaggtaa

DBGET integrated database retrieval system