KEGG   Syntrophus aciditrophicus: SYN_02878Help
Entry
SYN_02878         CDS       T00346                                 

Definition
acetyl-CoA synthetase / acetyltransferase (GNAT) family protein
Orthology
K09181  
acetyltransferase
Organism
sat  Syntrophus aciditrophicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2012347..2015103)
Genome map
AA seq 918 aa AA seqDB search
MPIRPMRSSRPWRCLMGNLNNVFNPGSVALIGASDREGSVGRIIFTNLLQAKDRKIFPVN
PKKKVILGRKCFENIADISEPVDLAVIATPAKEVPELVEDCGRAGIGGLVIISAGFKEIG
EEGRLLEERITASRKKYGMRILGPNCLGFVRPNEGLNATFLKTNPPPGHIAFISQSGALG
SAILDWAVNEHVGFSMFASLGAMSDVDFGDLIDFLGEDPDTRSILLYMEGVGNAKKFMSA
ARAFAMRKPIIVIKPGRFTESAQAARSHTGAMAGDDAIYEAAFKRAGVLRVKEIADLFDC
AEILDSRKLPKGPRLAIVTAAGGPGVMATDALIELGGELARLSDESMERLNSILPPFWSK
GNPIDLLGDADASRYAQAAQICLNDSGVDGVLVIYVPMDTAVPDEVAQAVIDTAKGSWKP
ILTAFMGADKVRSALEKLARNNIPNYETPEQAVRAYVNMYQDEINLELLYETPEELPGRE
TSQGDLKDLIVGVMKEKERLKGLISKALGEGRTLLNEDESKEFLAAYGIPTTVPSLTSSV
EEAVTVAGQIGYPVVIKIVSPDISHKTDVGGVVAGINSDEQLRHAYEGMLKRVRDHAPKA
LIEGVTVQKMIEDIDYELILGSKKDKDFGSVILFGMGGVTAELIRDFSIGLPPLNRTLAK
RLMEATKAYKLIQGWRGKPPANLGELETILVYFSYLIVDFPEIAEIDINPLAITGGVLCA
LDARIILDKDYRQSDAPYPHLVITPYPASLVTPLKSADGAEMVLRPIRPEDEPLERELLA
TLSEESRRTRFFSSFKNVTHEWLVLFCNIDYDRHIAMVAEIKENGERKIIGVARLILNPD
FDSGEIAVLVHDRFQRKGVGEELMKSVIEIGKSKGLSEIYGEVLMENEKMLGLFRKLGFA
TKRLSDGIMRSSLKLRQL
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
gtgccgatccgtccgatgcggtcaagtagaccttggaggtgtctaatggggaacctgaac
aatgttttcaatccaggcagtgtcgcgttaatcggtgcaagcgacagggagggctcggtg
ggacgaatcatcttcaccaaccttctccaggcaaaggatcgaaagatattcccggtcaat
ccgaagaaaaaagtcatactgggccggaaatgctttgagaatattgccgacatttctgaa
ccggtcgatctcgccgttattgccaccccggcgaaggaagttcccgaactcgttgaggat
tgcggccgggcgggtatcggcggactggtcattatctcggctggctttaaagagatcggc
gaggaaggcaggttactggaagagcggataacggcatcgaggaagaaatacggcatgcgc
atcctcggaccgaattgtctgggttttgtacggccgaatgaagggttgaatgcaaccttt
ctgaaaacaaacccgcctcccggacatattgccttcatctcccagagcggggcgctgggc
agtgccatccttgactgggcggtgaatgagcatgtcgggttcagcatgtttgcctcgctc
ggcgccatgagcgatgtggatttcggtgacctcatcgattttctcggcgaggatcctgac
acgcgaagcatcctgctctacatggaaggggtcggcaacgcaaagaagtttatgagtgcg
gcacgtgcttttgcaatgcgtaaacccatcattgttatcaaaccggggagatttaccgag
agtgcccaggcggcccgatcccataccggcgctatggccggcgacgacgccatctatgag
gcggccttcaaaagggcgggcgtgttgcgggtaaaggaaatcgccgatctctttgactgc
gctgaaattcttgattcacggaaactccccaaagggccgagactggccatcgtgaccgcc
gccggcggacccggtgtcatggcaaccgatgcactgatcgaactcgggggtgaacttgcc
aggctttctgacgaaagcatggaacggctaaactcgatcttgccgccgttttggagtaaa
ggcaatcccatcgatttgctgggggacgcggatgcctcccgatatgcccaggcagctcag
atctgtttaaacgattcaggggtggatggagtcctggtcatctacgttcccatggatacc
gccgtgccggatgaagtggcccaggctgtgattgacactgcaaaaggatcatggaagccg
attcttaccgccttcatgggggcggacaaggtccggagtgcattggaaaagctggcgcgg
aacaatatcccgaactatgaaacccctgaacaggcggtgagggcatatgtcaatatgtac
caggatgagataaaccttgaactgctctatgagactcctgaagaattgccgggccgggaa
acatcccagggggacctgaaggatctcatcgtgggggtcatgaaggaaaaggagcgcctg
aaaggtctcatcagtaaggcccttggtgaaggaagaacccttctcaacgaggatgaatca
aaagaattcctcgcggcctacggcatccccacgacggttccctcgcttacctcgtctgtg
gaagaggcggtaaccgttgccgggcagatcgggtatcccgtggtcatcaagattgtctct
ccggatatctcgcacaagaccgatgtcggcggcgttgtggcgggaatcaactcggacgaa
caactgaggcatgcctatgagggcatgttgaagagggttcgggatcatgctcccaaggca
ttgattgaaggcgtcaccgttcagaagatgattgaggacatcgattacgaactgattctg
ggctcaaaaaaggataaggatttcggttcggtcatcctctttggaatgggaggagtaacg
gctgagctgatcagggatttttcgatcggtctgcctccgctcaatcggacgctggcaaaa
aggctgatggaagctacaaaggcgtataaactgattcagggctggcgcggcaagccgccg
gccaatctcggggaactggaaaccatcctggtctatttctcctatctgatcgttgatttt
ccggaaatagcggaaatcgacatcaacccgctggccataaccggaggcgtactgtgcgcc
ctggacgcaaggattatcctggacaaggattatcggcagtcggacgctccttatccgcac
ctcgtgatcactccctatccggcaagtttagtaacgccgttgaaatcagcggatggcgcc
gagatggtgctgcggccgatccggcctgaagacgaaccgctggaacgggaactgcttgca
accctttccgaagaatcccggcgaacaagatttttctcgtcttttaaaaatgtcacccac
gagtggctggtcctgttctgtaatattgactatgaccgacacattgcgatggtcgctgaa
ataaaagaaaacggagaaagaaaaattatcggtgttgcgagactcatactgaaccctgat
ttcgactctggagaaattgctgtgctggttcacgacaggtttcagcgcaaaggcgttggg
gaagagctgatgaagagcgtcatcgagataggtaaatcaaaagggctgagcgagatatac
ggtgaggtgctgatggaaaacgaaaaaatgctcgggctcttcaggaaattgggattcgcg
acaaagcggctctcagatgggatcatgcggagcagcctgaagttgaggcagctgtaa

DBGET integrated database retrieval system