KEGG   Syntrophus aciditrophicus: SYN_02951Help
Entry
SYN_02951         CDS       T00346                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat00010  Glycolysis / Gluconeogenesis
sat00052  Galactose metabolism
sat00500  Starch and sucrose metabolism
sat00520  Amino sugar and nucleotide sugar metabolism
sat00521  Streptomycin biosynthesis
sat01100  Metabolic pathways
sat01110  Biosynthesis of secondary metabolites
sat01120  Microbial metabolism in diverse environments
sat01130  Biosynthesis of antibiotics
sat01200  Carbon metabolism
Module
sat_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SYN_02951
   00052 Galactose metabolism
    SYN_02951
   00500 Starch and sucrose metabolism
    SYN_02951
   00520 Amino sugar and nucleotide sugar metabolism
    SYN_02951
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SYN_02951
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SYN_02951
Enzymes [BR:sat01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SYN_02951
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ABC76640
UniProt: Q2LRD1
Position
complement(773060..774073)
Genome map
AA seq 337 aa AA seqDB search
MLEGGDHMLVLAGDIGGTSTRLAYFSTEGENLTLLVDERYPSRKAGSLKEIVSHFTGKHR
LTAETACFGIAGPARSGTVRTPNLPWSVNAEELAQALGIPKVQLINDMEAHLYGIDLLGP
ENFEVLNRGVPNPNGAIALVSAGTGLGEAIAYRDGTARRPCPGEGGHADFAPRNEIETEL
LLYLRDKYGRVSNERVLSGPGLHNIYLFLRDVRHLPESPEVAEELLVNDPPAVITKAALA
GRCPLCGQVLDLFVSLYGAEAGNAALRYLATGGIYLGGGIAPKIIERLKGPGFMLAFTSK
GRMSPLLETIPVMVILNEQSALLGAGRCAARRKEKES
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcttgaggggggagatcacatgctggtcctggcaggagatatcgggggcacatccacg
cggcttgcttatttcagcacagagggcgaaaatttgaccttgctggtggacgaacgctat
ccgagccgaaaggcaggaagtttgaaggagattgtcagccattttacaggaaaacacaga
ctgacggcggagacggcctgtttcggaatcgccggtcctgccaggagcggcacggtcagg
acacccaacctcccctggagcgtgaatgcagaggagctggcccaggccctgggaattccc
aaagttcaactgatcaacgacatggaggcacatctctatggcatcgatcttttaggtccg
gaaaatttcgaggtccttaacagaggagtccccaatccaaacggcgccatcgccctggtc
tcggcagggacgggactgggagaggccatcgcttatcgggatggcacagcccgtcgaccc
tgccccggcgaaggaggacacgccgacttcgctccccgtaacgaaatcgaaacggaactg
ctcctctacctccgcgataagtacggccgggtcagtaacgaacgggttttatccggcccc
ggactgcacaacatctatcttttcctgagagacgtgcggcatctgcccgaatcccccgag
gttgcagaggagctgctggtgaatgatcccccggcggtcatcaccaaggcggctctggcc
ggcaggtgccccctctgtggacaggttctcgatctctttgtctctctttacggagccgag
gcgggcaatgccgcgctgcgatacctcgccacaggaggaatctatctgggaggaggaatc
gccccgaagatcatcgaacggctgaaggggcccggcttcatgcttgcctttacctccaag
ggacgaatgagccctcttctggaaacgatcccggtgatggtcatcctcaacgaacagagc
gccctgctgggcgcgggccggtgtgccgcgcgaagaaaagaaaaagaatcatag

DBGET integrated database retrieval system