KEGG   Syntrophus aciditrophicus: SYN_02972Help
Entry
SYN_02972         CDS       T00346                                 

Definition
holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sat  Syntrophus aciditrophicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SYN_02972
Enzymes [BR:sat01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     SYN_02972
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
747690..748304
Genome map
AA seq 204 aa AA seqDB search
MIAQIRGKLILKTVSMVIIDNHGIGYEVMIPLSTYYELPDVGSEVSLFVYTFFKQDSILL
VGFCTENEKQLFKLMISVSGIGPRLAVNVLSGINSSELIHAIANNDLNRLLKVPGLGRKM
AQRVILELRDKVSGWTSKEQITFINNKKDAIDQSVMEEDAISALINLGYKSQAAKDAIDR
VISEGGENKSLDVILKKALKVLAM
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgattgcgcagattcgaggaaaactgatacttaaaaccgtatcgatggttatcattgat
aatcacgggatcggctatgaggtaatgattccgctatccacgtattatgaactacccgac
gtgggaagcgaagtcagtttgttcgtttataccttttttaaacaggattcaatacttctc
gtaggtttttgcacagaaaacgaaaaacagcttttcaagttgatgatttcggtttccggt
atcggtccgcgccttgcggtaaatgtgttgtccgggatcaactcgagtgaacttattcat
gccatagcaaataatgatttgaatcgtcttctgaaagttccgggtcttggaagaaaaatg
gcacaaagagtcattttggaacttcgggacaaggtatctggatggacatccaaagagcag
ataaccttcataaataataaaaaggatgcaatcgatcagagcgttatggaagaggatgcc
atctccgcgttgataaatctggggtataagagccaggcagcaaaggatgcaattgatcga
gtcatttcagagggtggtgaaaataaatcattggatgtgatcctgaagaaagcgctgaaa
gtactggccatgtag

DBGET integrated database retrieval system