KEGG   Syntrophus aciditrophicus: SYN_03227Help
Entry
SYN_03227         CDS       T00346                                 

Definition
(GenBank) succinyl-CoA synthetase beta chain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
sat  Syntrophus aciditrophicus
Pathway
sat00020  Citrate cycle (TCA cycle)
sat00640  Propanoate metabolism
sat00660  C5-Branched dibasic acid metabolism
sat01100  Metabolic pathways
sat01110  Biosynthesis of secondary metabolites
sat01120  Microbial metabolism in diverse environments
sat01130  Biosynthesis of antibiotics
sat01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sat00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SYN_03227
   00640 Propanoate metabolism
    SYN_03227
   00660 C5-Branched dibasic acid metabolism
    SYN_03227
Enzymes [BR:sat01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     SYN_03227
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 ATP-grasp_5 CPSase_L_D2 Ligase_CoA ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ABC75899
UniProt: Q2LPK9
Position
22960..24102
Genome map
AA seq 380 aa AA seqDB search
MRLHEYEALDIFERNGIPVPRRGVASTMHEALRVAGEIGYPVILKAQVLVGGRGLAGGIK
TASSPDELKEVAEALLSSDVKGLPVLKLLVCEKVEVAKELYVGITIDGYSGKPVIVASTE
GGMLIEETARTSPEKIAAIHVDSSLEFYPYQARTMLGRLSGINQQLLTSWTDVIGQLYNV
VMRYEPLICEINPLVVLPNGGLIAVDAVLEVDDSAISRVRFPLPDRVERIENPLERRGRE
IGVTYVDLDGDIGLISSGAGLGMASTDIIGERMKPANFLETGGGITADLLYKCMELIMMK
PGLRAVFINVYGGINPIHEGAKGVVRYIQEHNVKIPIVAKALGNRQEETWEIFRSAGVHV
VTEAATEKAIDRLYELVGRG
NT seq 1143 nt NT seq  +upstreamnt  +downstreamnt
atgagacttcatgaatacgaggctttggatatttttgaacggaacggcattcccgttccc
cgacgcggtgtcgcctccaccatgcacgaagcccttcgtgtggcaggcgaaatcgggtat
cccgttatactgaaggcccaggtccttgtcgggggccgtggcctcgccggcggaatcaaa
accgcttcttcgccggatgagttgaaggaggtcgccgaagccctgctgtcctccgacgtc
aagggactgcctgtcctcaagcttcttgtctgcgagaaggtggaggttgccaaggaactc
tacgtgggcattacaatcgatggatattcaggcaaaccggttatcgtggcgagcaccgaa
ggcggcatgctgattgaagagacggcgaggacctcgcctgaaaagattgccgcgattcat
gtcgactcgtccctggaattttacccctatcaggcccgtaccatgctggggcggctcagc
ggcatcaatcagcagcttctcacttcctggacggatgtcatcggccagctgtacaacgtt
gtgatgcgttacgagcccctgatctgtgaaatcaatcccctggtcgtccttcccaacgga
ggactgatcgccgtcgatgccgtgctggaggtagacgattcggccatatcgcgggtgcgt
tttcccctgccggatcgtgtcgaaaggatcgagaatccgctggaacgcagagggagagag
atcggtgtcacctacgtggaccttgatggggatatcggattgatctcttcgggcgccgga
ctgggcatggcctctacggacattatcggcgaaagaatgaaacccgccaacttcctggag
acgggcggcggcattaccgcggacctgctctataagtgcatggagctcatcatgatgaaa
ccgggactccgggccgtgttcatcaatgtttacggcggcatcaatcccatccacgaagga
gctaagggcgttgtgcgttacatacaggagcacaatgtcaagatacccattgtcgccaag
gcactcggaaaccgtcaggaggagacctgggagatcttccggtccgccggggtgcatgtc
gtcacggaagcggcaactgaaaaagcgatcgatcgcttatatgaactggtaggacgaggt
taa

DBGET integrated database retrieval system