KEGG   Syntrophus aciditrophicus: SYN_03272Help
Entry
SYN_03272         CDS       T00346                                 

Definition
recombination protein
Orthology
K06187  
recombination protein RecR
Organism
sat  Syntrophus aciditrophicus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sat00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SYN_03272
DNA repair and recombination proteins [BR:sat03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      SYN_03272
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
82268..82879
Genome map
AA seq 203 aa AA seqDB search
MAGYPLPIKHLISELGKLPGIGEKTATRLAMHILRAPEGDARALADSILEVRDKIRFCRV
CYNFSEAELCTVCRDSARDSSQICVVEDPDALMAIEDSGSYSGTYHVLHGVLSPLDGIGP
EQLKLRELVERIRESGVREVILATNPNVSGDSTALLISRMIGPLAVTVTRIAQGVPMGSD
LRYMDRMTLSKSLEFRRGMEKEP
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggcaggatatccccttcccattaaacatctgatttcggaactgggaaaacttccggga
atcggggaaaaaacggcgaccagactggcgatgcacattctgagagccccggaaggcgat
gctcgcgctctggccgacagcattctggaggttcgggataaaatccggttctgtcgggtc
tgctacaatttttccgaggccgagttgtgcacggtttgtcgcgattctgcccgggattcg
agtcagatctgcgtcgtcgaggatcccgatgccctgatggcgatcgaagacagcggaagt
tattcggggacttatcatgtcctgcacggcgttctgtctccgttggacgggatcgggcct
gagcagttgaaactgcgggaactggttgaacggatccgggaaagtggggtccgggaggtt
atcctggccacgaatcccaatgtttcgggagattcgacggcccttttgatttcccgtatg
atcgggccgctggctgtcaccgtgacccggatcgcccagggagttcccatgggcagcgat
ctccggtatatggatcggatgaccctgtccaaatcgctggaattccgccggggcatggag
aaagagccgtga

DBGET integrated database retrieval system