KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0342Help
Entry
SA0342            CDS       T00051                                 

Definition
(GenBank) ORFID:SA0342; acetyl-CoA C-acetyltransferase homologue
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
sau00071  Fatty acid degradation
sau00072  Synthesis and degradation of ketone bodies
sau00280  Valine, leucine and isoleucine degradation
sau00310  Lysine degradation
sau00362  Benzoate degradation
sau00380  Tryptophan metabolism
sau00620  Pyruvate metabolism
sau00630  Glyoxylate and dicarboxylate metabolism
sau00640  Propanoate metabolism
sau00650  Butanoate metabolism
sau00900  Terpenoid backbone biosynthesis
sau01100  Metabolic pathways
sau01110  Biosynthesis of secondary metabolites
sau01120  Microbial metabolism in diverse environments
sau01130  Biosynthesis of antibiotics
sau01200  Carbon metabolism
sau01212  Fatty acid metabolism
sau02020  Two-component system
Brite
KEGG Orthology (KO) [BR:sau00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SA0342
   00630 Glyoxylate and dicarboxylate metabolism
    SA0342
   00640 Propanoate metabolism
    SA0342
   00650 Butanoate metabolism
    SA0342
  Lipid metabolism
   00071 Fatty acid degradation
    SA0342
   00072 Synthesis and degradation of ketone bodies
    SA0342
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SA0342
   00310 Lysine degradation
    SA0342
   00380 Tryptophan metabolism
    SA0342
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SA0342
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SA0342
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SA0342
Enzymes [BR:sau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     SA0342
Exosome [BR:sau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SA0342
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C FAE1_CUT1_RppA
Motif
Other DBs
NCBI-ProteinID: BAB41566
NITE: SA0342
UniProt: Q7A7L2
Position
399116..400297
Genome map
AA seq 393 aa AA seqDB search
MTRVVLAAAYRTPIGVFGGAFKDVPAYDLGATLIEHIIKETGLNPSEIDEVIIGNVLQAG
QGQNPARIAAMKGGLPETVPAFTVNKVCGSGLKSIQLAYQSIVTGENDIVLAGGMENMSQ
SPMLVNNSRFGFKMGHQSMVDSMVYDGLTDVFNQYHMGITAENLVEQYGISREEQDTFAV
NSQHKAVRAQQNGEFDSEIVPVSIPQRKGEPILVTKDEGVRENVSVEKLSRLRPAFKKDG
TVTAGNASGINDGAAMMLVMSEDKAKELNIEPLAVLDGFGSHGVDPSIMGIAPVGAVEKA
LKRSKKELSDIDVFELNEAFAAQLLAVDRELKLPPEKVNVKGGAIALGHPIGASGARVLV
TLLHQLNDEVETGLTSLCIGGGQAIAAVVSKYK
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgacgagagtcgtattagcagcagcatacaggacacctattggcgtttttggaggtgcg
tttaaagacgtgccagcctatgatttaggtgcgactttaatagaacatattattaaagag
acgggtttgaatccaagtgagattgatgaagttatcatcggtaacgtactacaagcagga
caaggacaaaatccagcacgaattgctgctatgaaaggtggcttgccagaaacagtacct
gcatttacagtgaataaagtatgtggttctgggttaaagtcgattcaattagcatatcaa
tctattgtgactggtgaaaatgacatcgtgctagctggcggtatggagaatatgtctcag
tcaccaatgcttgtcaacaacagtcgcttcggttttaaaatgggacatcaatcaatggtt
gatagcatggtatatgatggtttaacagatgtatttaatcaatatcatatgggtattact
gctgaaaatttagtagagcaatatggtatttcaagagaagaacaagatacatttgctgta
aactcacaacataaagcagtacgtgcacagcaaaatggtgaatttgatagtgaaatagtt
ccagtatcgattcctcaacgtaaaggtgaaccaatcttagtcactaaggatgaaggtgta
cgtgaaaatgtatcagtcgaaaaattaagtcgcttaagaccagctttcaaaaaagacggg
acagttacagcaggtaatgcatcaggaatcaatgatggtgctgcgatgatgttagtcatg
tcagaagacaaagctaaagaattaaatatcgaaccattggcagtgcttgatggctttgga
agtcatggcgtagatccttctattatgggtattgcaccagttggcgctgtagaaaaggct
ttgaaacgtagtaaaaaagaattaagcgatattgatgtatttgaattaaatgaagcattt
gcagcacaattattagctgttgatcgtgaattaaaattacctcctgaaaaggtgaatgtt
aaaggtggcgctattgcattaggacaccctattggtgcatctggtgctagagttttagtg
acattattgcatcaactgaatgatgaagttgaaactggtttaacatcattgtgtattggt
ggcggtcaagctatcgctgcagttgtatcaaagtataaataa

DBGET integrated database retrieval system