KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0361Help
Entry
SA0361            CDS       T00051                                 

Definition
(RefSeq) hypothetical protein
  KO
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SA0361
   01230 Biosynthesis of amino acids
    SA0361
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SA0361
  Energy metabolism
   00680 Methane metabolism
    SA0361
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SA0361
Enzymes [BR:sau01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     SA0361
Exosome [BR:sau04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   SA0361
  Exosomal proteins of melanoma cells
   SA0361
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
418616..419221
Genome map
AA seq 201 aa AA seqDB search
MHKVRSNIMTIYLVRHGESKSNYDNKHFRSYFCGQLDVPLTDTGTKSADDLCDYFKEKQI
KHVYVSDLLRTQQTFEHIFPYDIASTTTPLLRERSLGVFEGEYKDEISANPKYEKYFNDP
NFKDFRHSFSQKAPEGESYEDVYQRVEHFMNHVVNEDTQKDDIVIVAHQVVIRCLMVYFN
KVSREEAVDLKVENCKPYIIE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atacataaggtaaggagtaatattatgacgatttatttagttagacatggcgaatcaaaa
tcgaattatgataataaacattttcgatcttatttttgtggacaattagatgtgccgtta
acggatactggcacaaaaagtgcagacgatttatgtgattattttaaagagaaacagatt
aaacatgtatatgtttcagacttattaagaacacagcaaacgtttgaacatatttttcca
tatgacattgcatcaacgactacccctctattaagagaacgttcacttggcgtatttgag
ggtgaatataaagatgaaatcagtgcgaatccgaaatatgaaaaatatttcaatgatcca
aactttaaagactttcgtcatagtttttcacaaaaagcgcctgaaggagaaagttatgaa
gatgtatatcaacgcgtagaacattttatgaatcatgttgtcaatgaagatacacaaaaa
gatgatattgtcattgttgcacatcaagttgtcattcgttgtttgatggtttattttaac
aaagtttcaagggaagaagctgtggatttaaaggtagaaaattgcaaaccatatatcatt
gaatag

DBGET integrated database retrieval system