KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA0964Help
Entry
SA0964            CDS       T00051                                 

Definition
hypothetical protein
Orthology
K02259  
cytochrome c oxidase assembly protein subunit 15
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
Oxidative phosphorylation
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Two-component system
Brite
KEGG Orthology (KO) [BR:sau00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    SA0964
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SA0964
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    SA0964
Mitochondrial biogenesis [BR:sau03029]
 Mitochondrial quality control factors
  Mitochondrial respiratory chain complex assembly factors
   Complex-IV assembly factors
    SA0964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
complement(1094834..1095745)
Genome map
AA seq 303 aa AA seqDB search
MFGKKNLKWLGVVATLMMTFVQLGGALVTKTGSADGCGSSWPLCHGALIPEFFPIDTIIE
LSHRAVSALSLLMVLWLVITAWKHIGYIKEIKPLSIISVGFLLLQALIGAAAVIWQQNDY
VLALHFGISLISFSSVFLITLIIFSIDQKYEADELYIKKPLRRLTWLMAIIIYCGVYTGA
LVRHADASLAYGGWPLPFHDLVPHSEQDWVQLTHRIMAFIVFTIIMITYIHAVKNYPNNR
TVHYGYTAAFILVILQVITGALSIMTNVNLIIALFHALFITYLFGMTTYFIMLMLRSVRS
DKQ
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
ttgtttggcaaaaagaatttaaaatggttaggtgtcgtagcaacgttaatgatgacattt
gtacaacttggtggagccttagttaccaaaaccggatcagctgatggttgtggttcttct
tggccactatgtcatggtgcgttgattccagaattctttcctattgatacgattattgag
ttaagtcatagagccgtttcagctttgtctttattaatggtcttatggttagttatcact
gcatggaaacatataggctatattaaagaaattaaacctttatcaatcattagtgttgga
ttcttattattgcaagcattaatcggagctgccgctgttatttggcaacaaaacgattac
gttttagcattgcactttggtatatcattaatcagtttctcatctgtatttttaataaca
ttgattattttctctatagatcaaaaatatgaagctgacgaattatatatcaaaaagcca
ttaagacgtttaacatggttaatggcaatcatcatttattgtggtgtttatactggtgca
ctagtgagacatgcggatgcaagtttagcatatggtggttggccattgccattccacgat
cttgtaccacattcagaacaagattgggttcaactcacgcatcgtatcatggcttttata
gtgtttacgattattatgattacttatattcacgctgttaaaaattatccaaataatcgt
actgttcattatggttatacagctgcatttatacttgttatattacaagttatcacaggt
gcattatctattatgacaaatgttaacctgataatcgcacttttccatgcattatttatc
acttatttatttggtatgacaacatactttatcatgctaatgttacgatcagtaagaagt
gacaagcaataa

DBGET integrated database retrieval system