KEGG   Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA): SA1205Help
Entry
SA1205            CDS       T00051                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sau  Staphylococcus aureus subsp. aureus N315 (MRSA/VSSA)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sau01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sau00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sau00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
NITE: 
UniProt: 
Position
1378154..1378882
Genome map
AA seq 242 aa AA seqDB search
MTKLFIPYIMGNKDLIENATLLSENGADIIEIGVPFSDPVADGPVIMEAGQQAIKQGITI
DYIFNQLEKHGDQIKCNYVLMTYYNIICHYGEQAFFEKCRDTGVYGLIIPDLPYELSQRL
KQQFSHYGVKIISLVAMTTDDKRIKDIVSHAEGFIYTVTMNATTGQNGAFHPELKRKIES
IKAIANVPVVAGFGIRTPQHVADIKEVADGIVIGSEIVKRFKSNTREEIIRYLQSIQQTL
NN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgactaaattatttataccttatattatgggcaataaagatttgattgaaaatgcaaca
ttgttgagtgaaaatggtgcagatataattgaaattggtgtacctttctctgatccggtt
gctgatggtccagttatcatggaagcaggtcaacaagcgattaaacaaggcatcacgata
gattatattttcaatcaattagaaaaacatggtgatcaaattaagtgtaactatgtatta
atgacgtattataatattatttgtcattatggagaacaagcgttttttgaaaaatgtcga
gatactggtgtctacggcttaattattcctgatttaccatatgaattatcgcagcgttta
aaacaacaatttagtcactatggcgtcaaaatcatatcgttagttgcgatgactactgat
gacaaacgtataaaagatatcgtatctcatgcggaaggctttatttatactgtgacgatg
aatgcgacaacaggacaaaacggtgcgtttcatccagaattaaaacgaaaaattgagtca
attaaagcgatagccaatgtgccagttgtcgcaggatttggtataagaacaccacaacat
gttgcagatataaaagaggttgcagatggcatcgtcattggtagcgaaatcgttaagcga
tttaaatctaacacgcgtgaggaaatcattagatatttacaatctatccaacaaacattg
aataattaa

DBGET integrated database retrieval system